KEGG   Bacillus velezensis CAU B946: BACAU_3517
Entry
BACAU_3517        CDS       T01692                                 

Gene name
ywfG
Definition
(GenBank) aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00998  Biosynthesis of various secondary metabolites - part 2
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
Module
baq_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:baq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BACAU_3517 (ywfG)
Enzymes [BR:baq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BACAU_3517 (ywfG)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-ProteinID: CCF07051
LinkDB
Position
complement(3711226..3712425)
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKEMEKTGAQIINLGQGNPDLPTPPHIVEALREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYLPDFERIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAAAALSGNPEHTERLKRTYKE
RIDFFTALCEKELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
GGKRYVRISMVAKQGDLREFVLRIQKLGLSFPSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagatggagaaaacgggagcccagattattaatctcggccagggg
aatcccgatctccccactccgccgcatatcgttgaagcattgcgggaagctgcgctgaat
ccttcgtatcacggatacggccctttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagagtacggggtatcggtcaatccggagacagaagtcgcgctgttc
ggcggagggaaagcaggtttgtacgttttgacgcaatgcctgctgaaccccggcgatatc
gccttagtcccgaaccccggctaccctgagtatttatcgggaatcacaatggccagagcg
gagctgcatgagatgccgcttcatccggaaaacggctatctgccggattttgagcggatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgacg
ggcgcgactgcggatcaggcgttttatgaaaaagcggctgcgtttgcaaaaaaacatgac
atccatcttattcacgattttgcatacggcgcgttcgaatttgatcagaacccggccagc
tttcttcaggcgaaagaagcgaaaacggtcggcgcggagctttattcattttcgaaaacc
ttcaatatggcaggctggagaatggcatttgccgtggggaatgagaaaatcattcaggcg
gtcaatgagtttcaggatcacgtcttcgtcggcatgttcggcggccttcagcaggcggca
gcggcggcgctgtcaggaaatcctgagcatacggagcgtctgaagcgcacatataaagaa
cggattgattttttcacggcgttatgtgaaaaggaattaggctggagcattgaaaaaccg
aaagggactttttatgtctgggctgaaattccgaatgaattcgagtcttcacaccagttt
tcggactatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggcagc
ggcggaaagcgttatgtcagaatatcaatggtggcaaaacagggcgatttaagggaattc
gtgctgcggattcaaaagctaggtttgtcctttccttcattacaagaaacatcccgctga

DBGET integrated database retrieval system