KEGG   Bacillus velezensis CAU B946: BACAU_3712Help
Entry
BACAU_3712        CDS       T01692                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
baq  Bacillus velezensis CAU B946
Brite
KEGG Orthology (KO) [BR:baq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BACAU_3712 (ahpF)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BACAU_3712 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CCF07246
LinkDB All DBs
Position
3910495..3912024
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGDDDTSKDMLALVDELASMSSKISVEKTELNR
TPSFSVNRTGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKADQKVIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAFKEEVESKNIMAVPTVFLNGESF
GSGRMTIEEILAKMGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKDYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVHKNAQTKEITGDQNVNGITF
VDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIIVDKSGATSVPGLFAAGDC
TDGPYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaatatcaaagcacaattaaatcaatacatgcagctaattgagaac
gacattgttctcaaagtaagcgccggtgacgatgacacttctaaggacatgctggctctc
gttgacgaactggcttccatgtcatctaaaatttcagttgaaaaaactgaattaaacaga
acaccgagcttcagcgttaatcgtaccggagaagacacaggcgttacattcgccggtgtt
cctctcggccacgaatttacatcattagtgctggcattgcttcaagtcagcggcagagcg
cctaaggctgatcaaaaggtcattgaccagattaagaacatcagcggagaataccgcttt
gagtcttatatcagcctgacgtgccacaattgccctgatgtcgtccaagcattaaacatg
atgagtgtgctcaacccgaatatcacacatacaatgattgacggcgcggcattcaaagaa
gaagtagaaagcaaaaacatcatggctgttccgactgttttcttaaacggtgaatctttc
ggcagcggccgtatgaccatcgaagagattctcgcgaaaatgggcagcggcgcagatgcg
tctgagtttgccgacaaagagccgtttgacgttcttgttgtcggcggcggacctgccggc
gcaagcgcggcgatctacacggcgcgtaaaggcatccgcaccggtgtcgtcgctgaacgc
ttcggcggccaggtactcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgact
gaaggaccgaagctcgctgcaagccttgaagagcacgtgaaagattatgatattgacgtc
atgaaccttcagcgcgcgaaacgccttgagaaaaaagacctcttcgaacttgaacttgaa
aacggcgctgtactgaaaagtaaaacagtgatcctttcaacaggtgcccgctggcgcaat
gtcaacgtacctggtgagcaagagttcaaaaacaaaggtgttgcatactgcccgcactgt
gacggaccattatttgaaggcaaagacgtagccgttatcggcggcggaaactccggaatc
gaagcggcgattgaccttgcaggtatcgtcaatcacgtgactgtgctggagttcgcgcct
gaactgaaagcagacgaagtcctgcaaaaacgtctttacagcctgccgaacgtcactgtg
cacaaaaatgcacaaacgaaagaaatcacaggcgaccaaaacgtaaacggcattacgttc
gttgaccgtgaaacaggcgaagaaaaacacgttgaactccaaggtgtattcgtccaaatc
ggtctcgtgcctaatacagaatggttagacgaaaccgtcgaacgcaaccgcatcggcgaa
atcatcgtcgataagagcggcgcgacaagcgttcccggcctatttgccgcaggggactgc
acagacggcccgtacaaccaaatcattatctccatgggatcaggtgcaactgccgcttta
ggcgcatttgattatttgatccggaattaa

DBGET integrated database retrieval system