KEGG   Bacillus anthracis Ames Ancestor: GBAA_0234Help
Entry
GBAA_0234         CDS       T00178                                 

Definition
(GenBank) oligopeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bar00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBAA_0234
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bar02000]
    GBAA_0234
Transporters [BR:bar02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    GBAA_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 IstB_IS21 TniB AAA_25 ATP-synt_ab AAA_16 NACHT AAA_7 DEAD RsgA_GTPase Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: AAT29315
UniProt: A0A0F7R849
LinkDB All DBs
Position
222954..223934
Genome map
AA seq 326 aa AA seqDB search
MSKAVVELKDLQTHFQTEEGTVKAVNHVSFSVREGETVCVVGESGCGKSVTALSIMGLIA
ESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSLNPVFTVGEQIVETLRE
HELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQRIMIAVALSCNPKLLIAD
EPTTALDVTIQAQILDLLRQIKREFKTSILLITHDLGVVAEMADYVVVMYGGKVIEEAPV
LEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVGLDEFCYFSGRCEHCMEICK
EEAPNLNVHDENHKVACWLYEERAGQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcggtagtagagctgaaagatttacaaacacactttcagacagaagaagga
acagtaaaagctgtgaatcatgttagtttttctgttcgagaaggtgaaactgtttgtgtt
gtaggtgaatctggttgcgggaaaagtgtaacagctttatccattatgggacttattgct
gaatcaggtagtgtagtaggcggagacattttatatgaaggaaaaagtcttttagggatg
aaagagaaagagcttcgtagtttacgagggaatgatattgcgatgattttccaagaaccg
atgacatcgctaaatccagtttttactgtaggggaacaaattgtagagacgttaagggag
catgaactgcttagtaaaaatgaagcatataagaaggcaattgagttaattcgtaaagtc
ggtatagcccgcgcggatgaaatcgtccattcttatccacacgaactgagcggtggtatg
ttacaacgtattatgattgctgttgcacttagttgtaatcctaagttattaattgctgat
gaaccgacaacggctcttgatgttacgattcaagctcaaatattagatttattaaggcaa
ataaaaagggaatttaaaacatccattttattaattacacatgacttaggtgtcgtagca
gaaatggctgattatgttgtcgttatgtatggcgggaaagttattgaagaagcaccggta
ctagagatatttcaaaatccgaaacacccatatacgaaaggattgttgaaatcaaaacca
gtgatgggaaaacgaatagataaactatattctattccagggcaagttcctaatttagtt
ggtttggatgagttttgctactttagcggtcgttgtgagcattgtatggaaatatgtaaa
gaagaagcaccaaatttgaatgtacatgatgagaatcataaagtagcttgctggttatat
gaggagcgtgcgggacaatga

DBGET integrated database retrieval system