KEGG   Bacillus anthracis Ames Ancestor: GBAA_2775Help
Entry
GBAA_2775         CDS       T00178                                 

Gene name
acoB
Definition
(GenBank) TPP-dependent acetoin dehydrogenase E1 beta-subunit
  KO
K21417  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta [EC:1.1.1.-]
Organism
bar  Bacillus anthracis Ames Ancestor
Brite
KEGG Orthology (KO) [BR:bar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GBAA_2775 (acoB)
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     GBAA_2775 (acoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AAT31891
UniProt: A0A0F7RHX1
LinkDB All DBs
Position
complement(2581688..2582722)
Genome map
AA seq 344 aa AA seqDB search
MTRTVSMSTAINEAMKISMRRDENVILIGEDVAGGAQVDHLQDDEAWGGVLGVTKGLVQE
FGRNRILDTPISEAGYMGAAMAAAATGLRPIAELMFNDFIGSCLDQVLNQGAKFRYMFGG
KAKVPVTVRTMHGAGFSAAAQHSQSLYALFTSIPGIKVVVPSTPYDAKGLLLAAIEDDDP
VIFFEDKTLYNMKGEVPEGYYTIPLGKADIKREGSDVTIVAIGKQVHTALAAAEQLAKKG
LEVEVIDPRSLSPLDEDTILSSVEKTNRLIVIDEANPRCSIATDIAAIVADRGFDLLDAP
IKRITAPHTPVPFSPPLEKLYLPTPEKVIETVSEMIGDQSLLHV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactagaacagtaagtatgtcaactgcaattaatgaagcgatgaaaatctcaatgcgt
cgtgatgaaaacgtaattttaataggagaagatgttgcaggtggtgcacaagttgatcat
ttgcaagatgatgaagcatggggcggtgttcttggtgttacgaaaggccttgtacaagaa
tttggccgaaatcgtattttagatacaccaatttcagaagcgggttacatgggagcagca
atggcagctgcggcaacaggactacgtccgattgctgaattaatgtttaatgattttatc
ggtagttgtcttgatcaagtattaaaccaaggtgcaaagttccgctatatgttcggtggt
aaagcgaaagtgccagttacagtacgtacgatgcatggtgcaggttttagcgcagctgca
caacattcacaaagtttgtatgcgttatttacgagcattccaggtataaaagttgtcgtt
ccttctactccatatgacgcaaaaggcttactattagcggcaattgaagatgatgatccg
gtaatcttctttgaagataaaacactctacaatatgaaaggtgaagtgccggaagggtat
tatacaattccattaggtaaagcagatattaaacgagaaggttctgatgtaacaatcgtc
gccattggaaaacaagttcatacagcacttgcggctgctgagcaattagcgaaaaaagga
cttgaagtagaagtgattgatccgcgttctttatcaccacttgatgaagatacaatctta
tcatctgttgaaaaaacgaatcgactgattgttattgatgaagcaaaccctagatgtagc
attgcgacagatattgcagcaattgtagcggatagaggatttgatttattagatgcacct
attaaacgaattacagcaccacatacaccagttccgttctcaccaccacttgaaaagtta
tatttaccaacgccggagaaagtaattgaaactgtatcagaaatgatcggagaccaatct
ttattacatgtgtaa

DBGET integrated database retrieval system