KEGG   Bacillus anthracis Ames Ancestor: GBAA_2831Help
Entry
GBAA_2831         CDS       T00178                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00010  Glycolysis / Gluconeogenesis
bar00053  Ascorbate and aldarate metabolism
bar00071  Fatty acid degradation
bar00280  Valine, leucine and isoleucine degradation
bar00310  Lysine degradation
bar00330  Arginine and proline metabolism
bar00340  Histidine metabolism
bar00380  Tryptophan metabolism
bar00410  beta-Alanine metabolism
bar00561  Glycerolipid metabolism
bar00620  Pyruvate metabolism
bar00625  Chloroalkane and chloroalkene degradation
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
Module
bar_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBAA_2831
   00053 Ascorbate and aldarate metabolism
    GBAA_2831
   00620 Pyruvate metabolism
    GBAA_2831
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GBAA_2831
   00561 Glycerolipid metabolism
    GBAA_2831
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GBAA_2831
   00310 Lysine degradation
    GBAA_2831
   00330 Arginine and proline metabolism
    GBAA_2831
   00340 Histidine metabolism
    GBAA_2831
   00380 Tryptophan metabolism
    GBAA_2831
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GBAA_2831
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GBAA_2831
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GBAA_2831
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GBAA_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAT31948
UniProt: A0A1Q4LYX8
LinkDB All DBs
Position
complement(2626524..2628008)
Genome map
AA seq 494 aa AA seqDB search
MLTTNIELKPKVKAFLDEEIKMFINGEFVPSISGKTFETYNPATEDVLAVVYEAQEEDID
VAVKAARSAFESGPWVEMTTAERAHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDD
IAATVENYRYYAGWATKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGA
ALATGCTIVLKPAEQTPLSLLYTAKLFKEAGFPNGVVNFVPGFGPEAGAAIVNHHDIDKV
AFTGSTVTGKYIMRQSAETIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNC
SAGSRVFVHRKHYETVVNELVKMANNVKLGAGMEKDTEMGPLVSKKQQERVLHYIEQGKA
EGATVAAGGERAFEKGYFVQPTVFTDVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANR
SSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGFKQSGIGRELGSYAL
DNYTEVKSVWVNIK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgacaaatattgagttgaaaccaaaagtgaaagcgtttttagatgaagagatt
aaaatgtttattaatggtgaatttgttccttctattagtggaaagacgtttgaaacatat
aatccagcaacagaagatgttcttgcagttgtttatgaagcacaagaagaggatattgat
gtggcagtaaaagcggcgagatctgcatttgaatcaggaccttgggtggaaatgactact
gctgaaagagcacatcttatttataaattagcagacttaattgaagagcatggagaagaa
ttagcacagctagaagctttagataatggaaaaccatatcaagtagcacttgatgatgat
attgcagcgactgtagaaaattatcgctattatgcaggatgggctacaaaaattatcggg
caaaccattccgatttcaaaagattacttaaattacacacgccatgaacctgttggcgtt
gtagggcaaattattccttggaattttccgctcgttatgtcttcttggaaaatgggagct
gcgctagcaacaggttgtacgatcgtattaaaaccagcagaacaaactcctttatcttta
ttatatacagcgaagctctttaaagaggctggttttccaaacggtgttgtaaactttgtt
ccagggtttggtcctgaagcaggagctgcaattgtaaaccatcatgatattgataaagta
gcctttacgggttcaacagttactggaaaatatattatgcgtcaatctgcagaaacaatt
aaacatgtaacgttagaactgggtggtaaatcaccaaatatcattttagaagacgctgat
ttagaagaagcgattaacggtgcattccaaggtattatgtataatcacggtcaaaattgt
agtgctggatctcgcgtgttcgttcaccgaaaacattacgaaacagtcgtaaatgaactt
gtgaaaatggcgaataacgtgaaacttggagcaggtatggagaaggacacggaaatgggt
ccactcgtatctaaaaagcaacaagagcgtgtgctacattacattgaacaaggaaaagct
gaaggcgctactgttgctgctggtggtgaacgtgcatttgaaaaaggttattttgtacag
ccaacagtattcacagatgttacggacgatatgacgatagttaaggaagaaatcttcggt
cctgttgtcgttgtacttccatttgattcgacggaagaagtaattgaaagagcaaatcgt
tcgtcatatggacttgcagcgggcgtatggacacaaaatattaaaacaggacatcaagtt
gccaataagttaaaggcaggaacagtatggattaatgattataacttagaaaatgcagcg
gcaccatttggtgggtttaaacaatctggtatcggccgtgagttaggttcatatgcactt
gataattacacagaagtgaaaagtgtttgggtaaatataaagtaa

DBGET integrated database retrieval system