KEGG   Bacillus anthracis Ames Ancestor: GBAA_4499Help
Entry
GBAA_4499         CDS       T00178                                 

Gene name
sodA1
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bar  Bacillus anthracis Ames Ancestor
Brite
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GBAA_4499 (sodA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAT33618
UniProt: Q81LW0
LinkDB All DBs
Structure
PDB: 

Position
complement(4093878..4094489)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacaccataacacgtacatcacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagttgca
aacttaaacgaagtaccagaagcaatccgtacagcagtacgtaacaatggtggcggacat
gctaaccacacattcttctggacaatcttatctccaaacggcggcggacaaccagtaggt
gaacttgcaactgcaattgaagcgaaattcggtagcttcgatgcgttcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaataatggt
gagttagaagtaacaagcacgccaaaccaagattctcctctaactgaaggtaaaactcca
gttatcggtttagatgtttgggaacatgcttactacttaaattaccaaaaccgtcgtcca
gattacatcggtgcattctggaatgttgtagattggaacgctgctgaaaaacgttaccaa
gaagcaaaataa

DBGET integrated database retrieval system