KEGG   Bacillus anthracis Ames Ancestor: GBAA_4644Help
Entry
GBAA_4644         CDS       T00178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bar  Bacillus anthracis Ames Ancestor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF421
Motif
Other DBs
NCBI-ProteinID: AAT33766
UniProt: A0A0F7RBK2
LinkDB All DBs
Position
complement(4222966..4223613)
Genome map
AA seq 215 aa AA seqDB search
MEWLSVIGRTMLLYIIILIIFRLMGKREIGELSVLDLVVFIMLGEMAVVAIENTDKSLWH
QLVPMVFLMCIQIILSVISLKFQRFRHLIEGEPAIIINAGKIDEKKMRNQRYNIDDLMMQ
LREQGVGDIRDVEYAILEPSGKLSVFQKQKGGQDALQFTLPLIIDGEIQSSHLQMIEHTD
EWLIGKLKNLGYNDIAQILYCSFQNGQFFVDLKEN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaatggctatcagtaattggccggacgatgctgttgtatattatcatcttaattatc
tttcgtcttatgggtaaacgtgaaataggagaattaagtgtattagatttagtcgtattc
attatgcttggtgaaatggctgtagtcgcaattgaaaatacggataaatcactttggcat
caattagtcccgatggtctttcttatgtgtatacagatcattttgtctgtcatttcttta
aagtttcaacgatttcggcatttaatagaaggtgaaccagcaatcattattaatgctgga
aaaattgatgaaaaaaagatgagaaaccagcgatataatatagatgatttaatgatgcaa
ttaagagagcagggagtcggagatattagggatgtagaatacgctattttagaaccatct
gggaagttatctgtctttcaaaaacaaaaaggcgggcaggacgcattgcagtttactctt
ccccttattatcgatggagaaattcaatctagccatttgcaaatgattgaacatacagat
gaatggcttattgggaaattaaaaaacttaggttataacgatatcgcgcaaattttatac
tgtagctttcaaaatggacaattttttgttgatttaaaagaaaactag

DBGET integrated database retrieval system