KEGG   Bartonella sp. A1379B: BA1379B_002100Help
Entry
BA1379B_002100    CDS       T05185                                 

Definition
(GenBank) glutamate N-acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bara  Bartonella sp. A1379B
Pathway
bara00220  Arginine biosynthesis
bara01100  Metabolic pathways
bara01110  Biosynthesis of secondary metabolites
bara01130  Biosynthesis of antibiotics
bara01210  2-Oxocarboxylic acid metabolism
bara01230  Biosynthesis of amino acids
Module
bara_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bara00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BA1379B_002100
Enzymes [BR:bara01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     BA1379B_002100
    2.3.1.35  glutamate N-acetyltransferase
     BA1379B_002100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AQX18057
LinkDB All DBs
Position
245125..246363
Genome map
AA seq 412 aa AA seqDB search
MAVKISPFSHKQPPEFPLLSGVRIATAKAGIKYKDRTDLLLIVFDKPANVAGVFTRSKCR
SSAVDHCRASLLHGIARGLVVNSGNANAFTGHKGKQTTNAIVHSASSILKAREDEIFIAS
TGVIGEPMDEACILNLLPDMASTAEEGCWLEAAKAIMTTDTFPKLATRQFDFGGELVTIN
GIAKGAGMIAPDMATMLSFVVSDAAISSDILQMMLSEAVQETFNSITVDSDTSTSDTLMI
FTTGKAKSCLPCLTSQSDPRYWIFVKHLRELLHELALQVVCDGEGARHLIEVSVIGATTN
SAAKTIALSIANSPLVKTAIAGEDANWGRVVMAIGKAGVEADRDRLKIWFGEHRLAVNGE
RDPHYNEKAVSAYMKGQHIKICVDIGLGSGKATIWSCDLTKEYVAINGDYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaaatatcgcctttttcacataaacaaccaccagaatttccactattatcc
ggtgtgcggatagctacagctaaagctggtattaagtataaagatcgtacagatcttctt
ttaattgtatttgataagccagctaatgtggcaggtgtttttacacgttcaaaatgtaga
tcttctgctgtagatcattgtcgtgcgtcccttcttcatgggattgctagaggtcttgtt
gttaattctggcaatgccaacgcttttacggggcacaaaggtaagcagacgacaaatgca
atagttcattctgcatctagtattttgaaagcgagagaagatgaaatttttatagcttct
acgggtgttattggtgagccaatggatgaggcttgtattttaaatcttttacctgatatg
gcttctacagcagaggagggatgctggttagaagctgcgaaagctattatgacaactgat
acgtttccaaaacttgcaacgcgtcaatttgactttgggggagagcttgttactattaat
gggattgcaaaaggtgctggtatgattgcaccagatatggcaacgatgctttcttttgtg
gtaagcgatgcagcgatttcttcagatatactccaaatgatgttatcagaggctgttcag
gaaacttttaattcaattactgttgatagtgatacttcgacgtctgatacattaatgatc
ttcacaacaggaaaagcgaagagttgccttccttgtttgacaagccaatcagatcctcgt
tattggatatttgtaaagcacctgcgtgagcttttgcacgaacttgcattacaagttgtt
tgtgatggtgaaggagctcgtcatttaattgaggtatctgttattggtgctacaacaaat
agtgctgctaagactattgctttatcaattgcaaattcaccacttgtaaaaacagctatt
gcaggcgaagacgctaattggggaagagttgttatggcgattggtaaggcaggtgttgaa
gcagatcgtgatcgattaaaaatttggtttggtgaacatcgtttggctgttaatggtgaa
cgtgatcctcattataatgagaaagcagtgagtgcttatatgaaaggtcaacatattaaa
atttgtgttgatattggtcttggaagcggaaaagcaacaatttggtcttgtgacttaaca
aaagaatatgttgcgattaatggtgattatagaagttga

DBGET integrated database retrieval system