KEGG   Bartonella sp. A1379B: BA1379B_002110Help
Entry
BA1379B_002110    CDS       T05185                                 

Definition
(GenBank) 8-oxo-dGTP diphosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bara  Bartonella sp. A1379B
Brite
KEGG Orthology (KO) [BR:bara00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bara03400]
    BA1379B_002110
Enzymes [BR:bara01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BA1379B_002110
DNA repair and recombination proteins [BR:bara03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BA1379B_002110
 Prokaryotic Type
    BA1379B_002110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 NUDIX NUDIX_2 HTH_3
Motif
Other DBs
NCBI-ProteinID: AQX18058
LinkDB All DBs
Position
246463..246909
Genome map
AA seq 148 aa AA seqDB search
MIVIYYSFGHSMHIKNSLLLVVACALLDHDNRVLLAQRPQGKSLAGLWEFPGGKIENGET
PETSLIRELAEELGIHVRQDNLLPLTFASHNYETFHLLMPLYICHRYEGVPKGREGQNLE
WVCMSSLDEYSMPDADKPLIQALKNFVL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgatagttatctattattcttttggtcatagtatgcatataaaaaattcactccttctt
gttgttgcatgtgctttattagaccatgataatcgagtgttgcttgcgcaacggcctcaa
ggaaaatcgctagctggtttatgggaatttcccggtggaaaaattgaaaatggtgaaacg
ccagagacatcgttaattcgtgagttagcagaagagcttggtattcatgttcggcaggat
aatttattacccttaacatttgcaagccataattatgaaacctttcacctgttaatgcca
ttgtatatttgccaccgttatgagggcgttccaaaaggacgagaaggacaaaatttagaa
tgggtttgcatgagcagtcttgatgaatattctatgcctgatgctgataagccattgatt
caagctctaaaaaattttgttctttaa

DBGET integrated database retrieval system