KEGG   Bartonella sp. A1379B: BA1379B_003360Help
Entry
BA1379B_003360    CDS       T05185                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bara  Bartonella sp. A1379B
Brite
KEGG Orthology (KO) [BR:bara00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bara03012]
    BA1379B_003360
   03029 Mitochondrial biogenesis [BR:bara03029]
    BA1379B_003360
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bara04147]
    BA1379B_003360
Translation factors [BR:bara03012]
 Eukaryotic Type
  Elongation factors
   BA1379B_003360
 Prokaryotic Type
   BA1379B_003360
Mitochondrial biogenesis [BR:bara03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BA1379B_003360
Exosome [BR:bara04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BA1379B_003360
  Exosomal proteins of breast cancer cells
   BA1379B_003360
  Exosomal proteins of colorectal cancer cells
   BA1379B_003360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AQX18178
LinkDB All DBs
Position
402372..403547
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEERARGITIST
AHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDSELLELVELEVRELLSKYDFPGDDIPIVKGSALAALEDSNKS
IGEDSVRLLMSEVDKYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGIIKVGEEI
EIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGVDREGIERGQVLAKPGSVTPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVAMDVSL
IVPIAMEEKLRFAIREGGRTVGAGIVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgaacgtacgaagccgcatgttaatataggtacgattggtcat
gttgatcatgggaagacttcattgacagcagcgattacgaagtattttggtgaatttaaa
gcgtatgaccaaattgatgcggcgcctgaggagcgggcacgtggtataacgatatctact
gcgcacgttgagtatgaaacggagagccgtcactatgctcacgttgattgtcctggtcat
gcggattatgttaagaacatgattacaggagcggcccaaatggatggtgcgatattagtt
gtttctgcagcagatggacctatgcctcaaacgcgtgagcatattttgttggcccgccag
gttggagttccagcgattgttgtttttctcaataaagttgatcaggttgatgatagcgag
cttttagagcttgtagagcttgaagttcgtgagcttttatcgaaatatgattttccggga
gatgatattcctatagttaagggttcggctttggctgcgcttgaggattcaaataagagt
ataggtgaagattctgttcgtcttttgatgagtgaagttgataaatatataccgacccct
gagcgtccagttgatcagccgtttttgatgcctatcgaggatgttttttctatttctggt
cgtggtacggttgttacaggtcgtgttgagcgtggcattattaaagttggtgaagagata
gagattattggaattcgtcctacatctaagacgacggttaccggggttgaaatgtttcgg
aaacttttagatcaaggtcaggctggtgataatataggcgctttgcttcgtggagttgat
cgtgaggggattgaacgtggtcaagtattggcgaaacctggttctgttacacctcatact
aaatttaaagctgaggcttatattttaacgaaagatgaggggggacgtcacacaccgttt
ttcacaaactatcgtcctcaattttattttcgtacgaccgatgttacaggtatagttacg
cttcctgaaggaacggaaatggttatgccgggtgataatgttgcaatggatgtttctttg
attgttccaatcgcaatggaagagaagcttcgttttgcgatccgagaaggtggtcgcacc
gttggggccggtatcgtatctaaaattattgaatag

DBGET integrated database retrieval system