KEGG   Bartonella sp. A1379B: BA1379B_007540Help
Entry
BA1379B_007540    CDS       T05185                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bara  Bartonella sp. A1379B
Pathway
bara00473  D-Alanine metabolism
bara01100  Metabolic pathways
bara01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bara00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BA1379B_007540
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BA1379B_007540
Enzymes [BR:bara01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BA1379B_007540
Peptidoglycan biosynthesis and degradation proteins [BR:bara01011]
 Precursor biosynthesis
  Racemase
   BA1379B_007540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AQX18578
LinkDB All DBs
Position
869409..870530
Genome map
AA seq 373 aa AA seqDB search
MDKFVGYEENAILPYTAIATIDIGAIIANYKTLVQRVAPVECSAVVKADAYGLGAEKIAP
ALYQAGCRTFFIAHLKEALQLKAILPNNVTLILLNGIPPTAEEFVTQTGIVPVLNSRNEI
ENWQMHCQKNGKKFPAIIQIDTNMNRLGLDQEELQWLIQNPTLFEIADIKYIISHLANGD
NATHTSNCEQKNAMKKALAQLPACKASLANSGGIFLGPDFYFDLVRPGIGLYGIDPHQKH
PTSLKSVLKLKAQVIQSRCTEAGTPVGYGGSFITQKPSILTTISIGYADGWLRNLSNKGS
VYFNQHKLPIIGQISMDSIIVDATNLKHEKPKRGDWVELIGKHQTVENVAADAGTIPYEI
LTSLGSRYKRIYI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggacaagtttgttggttatgaagaaaatgcaatactaccttatactgcgatagcaact
attgatattggtgcaattattgctaattataaaaccttagtccaacgtgttgctcctgta
gaatgttcagctgttgtaaaagctgatgcctatgggctaggagctgaaaaaattgcccct
gcactttatcaagctggttgccgcactttttttattgcccatcttaaagaagcactccaa
ttaaaagctattttaccaaataatgttacccttatccttctgaatggtattccccctact
gcagaagaattcgtgactcaaactggtattgtccctgttcttaattctcggaatgaaatt
gaaaactggcaaatgcattgtcaaaaaaatggtaaaaaatttccagcaatcattcaaatt
gatactaatatgaatcgactagggctcgatcaagaagagctacaatggttgatccaaaat
cctactctcttcgaaatagcagacataaaatacattatcagccaccttgctaatggagac
aatgcaacacacacatccaattgcgaacaaaaaaacgctatgaaaaaagcacttgcacaa
cttcctgcctgtaaagcttcacttgctaattctggaggaatctttcttggcccagacttt
tattttgatcttgtccgcccaggtattggactttatggaattgatccccatcaaaaacat
cccacatctcttaaatctgttttaaaacttaaggctcaagttattcaaagccgttgcact
gaagcgggaactcctgtgggttatgggggaagtttcatcactcaaaagcccagcattctt
accaccatttctattggttatgccgatggctggctacgaaacctttctaacaaaggttcc
gtttatttcaaccaacacaaactacccatcattggacaaatctctatggattctattatt
gttgatgcaaccaatcttaagcatgaaaaaccaaaacgtggtgattgggtagaacttatt
ggaaaacatcaaactgtcgaaaatgttgctgcagatgcagggactattccttacgaaatt
cttacttctcttggttctcgttataaacgtatttacatttaa

DBGET integrated database retrieval system