KEGG   Bartonella sp. A1379B: BA1379B_008270Help
Entry
BA1379B_008270    CDS       T05185                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bara  Bartonella sp. A1379B
Pathway
bara00061  Fatty acid biosynthesis
bara00780  Biotin metabolism
bara01100  Metabolic pathways
bara01130  Biosynthesis of antibiotics
bara01212  Fatty acid metabolism
Module
bara_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bara00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BA1379B_008270
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BA1379B_008270
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BA1379B_008270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bara01004]
    BA1379B_008270
Enzymes [BR:bara01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BA1379B_008270
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BA1379B_008270
Lipid biosynthesis proteins [BR:bara01004]
 Fatty acid synthase
  Component type
   BA1379B_008270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AQX18651
LinkDB All DBs
Position
complement(950196..951014)
Genome map
AA seq 272 aa AA seqDB search
MADSNNLLCGKRGLILGLANNRSIAWGIAKAASAAGAELAFTYQGEALKKRVEPLAEEVR
GIVCGHCDVSDSKSIDTVFNEIERKWGKLDFLVHAIGFSDKDELSGRYIDVSESNFMMTM
NISVYSLTALTQRAEKLMSGGGSILTLTYYGAEKVVPNYNVMGVAKAALEASVKYLAVDL
GPKNIRVNALSAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIEEVGDSALYFLSDLS
RSVTGEVHHVDSGYHIIGMKAVDAPDISVIKE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctgatagtaataatttattatgcggtaagcgtggtctaattttggggttggccaat
aatcgatctattgcatggggaatagctaaggcagcaagtgctgcaggagcagagcttgct
tttacttatcaaggtgaagcattgaagaagcgtgttgaacctttggccgaagaagtaaga
ggaattgtttgtggtcattgtgatgtatctgatagtaaatctattgatacagtttttaat
gaaatagaaagaaaatggggtaagcttgattttttagttcatgctattggtttttctgac
aaagatgaattaagcggtcgttacattgatgtcagcgaatcaaattttatgatgacaatg
aatatttctgtttattctttgacagctcttacacagcgtgcagaaaagttgatgtcaggt
ggtggttcgattttaacattgacttattatggtgctgagaaagttgttcctaactataat
gtgatgggggttgctaaggctgctcttgaggctagcgtaaaatatttagctgtagattta
ggaccgaagaatattcgtgttaatgctttgtcagcagggcctataaaaacgttggctgct
tccggtattggtgactttcgttatattcttaaatggaatgagtataatgctcctttacgt
cgtacagtgacaatagaagaggttggtgattctgcgctatactttctttcagatttatct
cgttctgttacgggagaagtacatcatgtagattcagggtatcatattataggtatgaaa
gccgttgatgcaccagatatttccgttattaaagagtaa

DBGET integrated database retrieval system