KEGG   Bartonella sp. A1379B: BA1379B_008770Help
Entry
BA1379B_008770    CDS       T05185                                 

Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bara  Bartonella sp. A1379B
Brite
Enzymes [BR:bara01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BA1379B_008770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQX18700
LinkDB All DBs
Position
complement(1008274..1008876)
Genome map
AA seq 200 aa AA seqDB search
MTFELVELPYDYDDLSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLGNKNLTDLVKES
FGKNPGLFNNAAQYYNHNHFWHWMKKGGGGQKLPAKLAKAIESDLGGYDKFRADFMAAGV
AQFGSGWAWVALKDGKLEIMKTPNGENPLIHNAQPILGVDVWEHSYYIDYRNARPKYLEA
FVDHLINWDYVLELYESYGL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgaattagttgagttaccttatgattatgatgacctttcgccttatatgtca
cgcgagacacttgaatatcatcatgataaacaccaccttgcttatctgacaaacactaat
aattttgtaaaagatttaggcttagggaataagaatcttacagatcttgttaaagaaagc
tttggaaaaaatcctggtttatttaataacgcagctcagtattataatcacaaccatttt
tggcattggatgaaaaaaggtggagggggacaaaagcttcctgcaaaattagccaaagct
atcgagtctgatctaggtggttatgataaattccgtgcagattttatggcagctggcgtt
gctcaatttgggtctggttgggcgtgggttgctcttaaagatggtaaattagaaattatg
aaaacacccaatggtgagaatcctttaattcataatgcgcaacctattttaggcgttgat
gtgtgggagcactcctattatattgattaccgtaatgctcgtccaaaatatttagaggca
tttgtggatcatttaattaattgggattatgttttagaactttatgaaagctatgggtta
tag

DBGET integrated database retrieval system