KEGG   Candidatus Bathyarchaeota archaeon BA2: AOA66_0283Help
Entry
AOA66_0283        CDS       T04066                                 

Gene name
lig_1
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
barb  Candidatus Bathyarchaeota archaeon BA2
Pathway
barb03030  DNA replication
barb03410  Base excision repair
barb03420  Nucleotide excision repair
barb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:barb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOA66_0283 (lig_1)
   03410 Base excision repair
    AOA66_0283 (lig_1)
   03420 Nucleotide excision repair
    AOA66_0283 (lig_1)
   03430 Mismatch repair
    AOA66_0283 (lig_1)
Enzymes [BR:barb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AOA66_0283 (lig_1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     AOA66_0283 (lig_1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AOA66_0283 (lig_1)
DNA replication proteins [BR:barb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AOA66_0283 (lig_1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AOA66_0283 (lig_1)
DNA repair and recombination proteins [BR:barb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AOA66_0283 (lig_1)
   NER (nucleotide excision repair)
    Other NER factors
     AOA66_0283 (lig_1)
   MMR (mismatch excision repair)
    Other MMR factors
     AOA66_0283 (lig_1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: KPV64323
UniProt: A0A0P9I515
LinkDB All DBs
AA seq 586 aa AA seqDB search
MRYSLIADSYEKIEATTKRLEMTDYLVELLKKTPKDIIDKVVYLTQGKLYPDFFGIEIGV
AEKLAVRAVAKATGHSEKEIEENLEKTGDLGTTAQIFLERKAQVTLFQEPLTVERVYENL
DKMAKATGPRSMEHKINLLAGLLTNATPKEARYVARTVTGSLRLGIADMTVLDALAIAFG
GGKETREILERAYNISSDLGSVAKIVAEKGIKGIERFEVSLGEPIRPMLAERLGSPIEIL
EKLGGKCIAEYKYDGERVQAHKREGHVTLFSRRLEDISDQYPDGSELIRKHVKAKEAIIE
AEVVAIDPDTGEMRAFQELMHRRRKYGVKKAIKEYPVSLFMFDALYVDGKDLTLEPYPVR
RQHLEKIIEQADHVKVAEYIITGDPEELERFFEKAVENGCEGLVCKSVNEDSVYQAGARG
WLWIKYKRDYKSEMTDTVDLVVVGAFHGRGKRAGSYGALLLAAYNPEEDVFKTVTKCGTG
FTDEDLEKLPKNMEKHRIPHRHSRVYSTIEADVWFEPVVVIETIGAEITLSPIHTCAMDV
IRKGSGLAIRFPRFTGNYRLDKSAEDATTVKEIVEMYRKQLKKVAG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttgagatactccctcatcgcggactcttatgaaaaaattgaggctactacaaagcgtctg
gaaatgacagactacctagttgaactcctcaaaaaaactcccaaggatatcattgacaag
gttgtctacctaacgcagggaaaactatatccagacttttttgggattgaaatcggagtt
gccgagaagctagctgtacgggcggttgccaaagcaacaggtcacagcgagaaggaaatc
gaggagaatctggaaaaaaccggggacttaggcacgactgctcaaatattcttggaaaga
aaagcccaggtgacgctctttcaggaaccgctgactgttgaaagggtgtacgaaaactta
gacaagatggcaaaggcaaccggtccaaggtccatggagcataagataaaccttttagcc
gggctcctaaccaacgccaccccaaaggaggcaaggtatgtcgctagaacagtgactggc
agtttgagattaggaatcgctgacatgactgttcttgacgcgttggctatagccttcggt
ggtggcaaggagacccgagagattctggagcgagcgtataatatttcgtccgatttaggt
agcgtggcaaaaatcgtcgcagagaaaggaatcaaaggtattgaaaggtttgaggtttcg
cttggtgaacccatcagacccatgttggcagaacggttaggctcacccatcgaaatcctt
gaaaaacttgggggaaaatgcatagccgaatacaagtatgacggagagagagtgcaagcc
cacaaaagggaaggtcatgttacgcttttttctcggcgactcgaagacatcagtgatcag
tatccagacggcagcgaattaattaggaaacatgtgaaggcgaaagaggctatcatcgaa
gcagaagtcgttgcaatagatcctgatacaggcgaaatgagagctttccaagagctgatg
catcgaaggcgcaaatacggcgtaaaaaaggccataaaggaatatcctgtttcccttttc
atgtttgacgccctttatgttgatggaaaggacctaaccctagaaccctaccctgttaga
cgccaacatcttgagaagattattgaacaagccgatcacgtcaaggtggcggagtacatt
atcaccggtgatccagaggaattagagcgattttttgaaaaagccgtagagaacggttgc
gaagggctggtctgtaaatcagtgaatgaagactcggtttatcaggctggggcgaggggt
tggctctggataaaatataaacgtgattataagagtgaaatgactgataccgttgacctt
gtggttgtaggagctttccatggccgagggaaacgtgctggaagctacggcgcccttctt
cttgccgcctataatcctgaggaagacgtgttcaagaccgttaccaagtgtgggacagga
ttcaccgatgaggatcttgaaaaacttccgaaaaatatggaaaaacatcggataccgcat
cgacattctagggtttattcaaccatcgaggcggatgtttggtttgaaccagttgtcgtc
atagagactattggcgccgagataacgcttagtcccattcacacatgcgccatggacgtt
atcagaaagggaagtggactagccatacggtttccacgctttacggggaactatcgtctg
gacaagtctgctgaggatgcgacaaccgtcaaggaaattgttgaaatgtataggaaacag
ttgaaaaaagtggctggttag

DBGET integrated database retrieval system