KEGG   Bathyarchaeota archaeon BA2: AOA66_1772Help
Entry
AOA66_1772        CDS       T04066                                 

Gene name
aor_4
Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
barb  Bathyarchaeota archaeon BA2
Pathway
barb00030  Pentose phosphate pathway
barb01100  Metabolic pathways
barb01120  Microbial metabolism in diverse environments
barb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:barb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AOA66_1772 (aor_4)
Enzymes [BR:barb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AOA66_1772 (aor_4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: KPV61802
UniProt: A0A0P9E4V5
LinkDB All DBs
AA seq 627 aa AA seqDB search
MFGYMGKILRVDLSKSKITKEFPDENTLKMFLGGSGLATKYLFDEVKKGTDPLGPENKLI
FTTGPLTGTPSPTTGRYTVVAKSPLTGFWGQANSGGFWGATFKRSGFDGVIFEGISPKPV
YLVTDDGKAELKDAKDLWGKNTSETTRLIKEELGENFRVTCIGVAGENLVKYAAIINDAD
RPNWGRAAGRCGMGTVMGSKRLKAIASRGTIKIEVAKEDAYREEAKKRYNWVKEEVEKTA
TLSYFFRRYGTAVALDFVNIRGGLATRNWQTGVFQGADNINGPAIVEKILTDKKACFACP
LSCGRISEIKTGPYASKGEGPEWQALAAFGSKCGIDNLEAITYGQFLCNEYGLDFISAGN
TIAFAMECYEKGVLTKKDTDGLELKFADSDVMIELVHKIAKREGVGNLLAEGTKIVSEKL
DKGTEKFAMHVKGLELPGYDPRAAKIAGLAYATANRGGCHTTAYIAVLVFIGIPSFLEEI
DVGDILQEIPETAKVVKDLEDVLAVFDAMGGCKFMGMVSTTEDWATLISNLTGWEFTTKD
FRRTGERIYNLERAFNIREGLTRADDTLPKRLLEEPMPEGPAEGQVVNLNPLLDAYYEFR
GWDKKTGKPTPEKLKELGLDEVIKEIY
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggttacatgggaaagattttaagagttgacttgtcaaaatcaaaaataaccaaa
gaatttcctgatgagaacactcttaagatgtttttgggcggaagcggactagcaaccaaa
tatctctttgatgaagttaaaaagggaacagaccccttgggcccagaaaacaagctaata
ttcacgactggacctttaactggaacgccgtcacctactactggaagatatacggtagtc
gccaaatctccccttactggtttttgggggcaggcaaactcaggtggtttttggggagca
actttcaaaaggtcgggttttgacggagtaatatttgaaggtatctcaccgaaaccagtc
taccttgttaccgatgacgggaaggccgagcttaaagatgcaaaagacctctggggtaag
aacacttcagaaactacaagattgatcaaagaggagcttggagagaatttccgtgtcact
tgtataggcgttgctggagagaatctagtcaaatacgctgctatcataaatgacgctgat
agaccaaactggggcagagcggctggaagatgcggaatgggaaccgtaatgggttcgaaa
cgcttgaaagctatcgcttcaagagggacaataaagatcgaagtggcaaaggaagatgct
tacagggaagaggccaaaaaaagatacaactgggttaaggaggaagtagagaaaacagcc
actctttcatacttctttaggaggtatggaacggccgttgcccttgatttcgtgaacatt
cggggtggacttgcaaccagaaattggcaaaccggcgtctttcaaggtgcagacaatata
aacggacctgcaattgtagaaaagattcttacagacaaaaaagcttgctttgcgtgtcca
ctctcttgtggaagaatatctgaaattaaaacaggaccatatgcaagcaaaggagaaggc
ccggaatggcaagctcttgcagcttttggtagtaagtgtggaatcgacaatctagaagca
attacctacgggcaatttctatgcaatgaatatggtctcgattttatttctgctggaaat
acaatagcttttgctatggaatgctatgagaaaggagtattgaccaaaaaagacaccgac
ggattggagcttaaatttgccgattctgatgtcatgatagaacttgtgcacaaaatagct
aaaagggaaggcgttggaaatctactagccgaaggaacaaagatcgtctcagaaaaactg
gataaaggaaccgaaaaatttgctatgcatgttaaaggtctagagctgccaggttatgat
cccagagctgccaagatagctgggctagcctatgctactgcaaatcgaggaggttgccac
acgacggcttacatagcagtcttggtttttattggaataccctcctttcttgaagaaatc
gatgttggagatatacttcaggaaattcctgaaactgctaaggttgtcaaagatctggag
gatgtgcttgccgtttttgatgcgatggggggatgcaaatttatgggaatggtttcaacc
acagaggactgggcaactttgatatcgaatcttaccggctgggaatttactacaaaggac
tttagaagaactggtgagagaatttacaatcttgaaagagcctttaacataagagaggga
ttaactagagccgatgatactcttccaaagcgtttactagaggaaccaatgcccgaaggc
ccagctgaaggacaggtagtaaatctaaatccactcttggatgcttattacgagtttcgt
ggatgggacaagaaaactggcaaaccaactcctgagaagcttaaagaacttggactagat
gaggtaattaaagagatttactag

DBGET integrated database retrieval system