KEGG   Candidatus Bathyarchaeota archaeon BA1: AOA65_1742Help
Entry
AOA65_1742        CDS       T04065                                 

Gene name
aor_6
Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
barc  Candidatus Bathyarchaeota archaeon BA1
Pathway
barc00030  Pentose phosphate pathway
barc01100  Metabolic pathways
barc01120  Microbial metabolism in diverse environments
barc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:barc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AOA65_1742 (aor_6)
Enzymes [BR:barc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AOA65_1742 (aor_6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: KPV62615
UniProt: A0A0P9FV42
LinkDB All DBs
AA seq 591 aa AA seqDB search
MNGWMGEIVRVNLSRGEVVTQKLDENTTKNFLGGRGLGVRVLYDELKPKTNPLSPENKIV
FATGPVTGTKAPTSGRYCVISKSPLTGTIFDSHSGGFWGPELKFAGYDAAIIEGKAETPV
YIWINDGGVEIRGASEVWGLDTHMTTERLIKETDPKAKVACIGPAGERQVSLAAIINDRH
RAAGRGGLGAVMGSKNLKAVVVRGTCRVDVADEGGFSEALDESLMVIRKNPITDKSLPTL
GTAVLVNLINEHGMYPTRNFQEGVFEDAEGISGEKIAETILNGRRACYACPIACGRITKT
SEKEGEGPEYETAWAFSAQCGINDLTQVTHANYLCNELGLDTISTGNTIGCAMEMSQKGF
LREKIEFGDADKLVELVKKIALREGIGKELGEGSKRLAERHGCPELAMQVKGLELPAYDP
RGAQGHALAYATSNRGGCHLRAYLIGPEILGTPALVDRFRPDGKADLVITYQNLFAALDS
MILCVFTSFALSPDHYAKFTSAVTGLRFADEDVMKIGERIWNLERLFNMREGFGKKDDTL
PLRFLKTPLPEGGSRGRRVLLDKMLKEYYDLRGWDGEGFPLKSKLKELGLS
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggtggatgggcgaaattgttagagtaaatttaagcaggggggaggtggtcaca
caaaaactggatgagaatacaacaaagaattttcttgggggaagaggtctaggggttagg
gtgctgtacgatgaactgaagccgaagacaaatccgttaagcccagaaaataaaatagta
ttcgccacaggccctgttactggaactaaggcaccaacatctggcaggtattgtgtcatc
tccaaatctcctctaaccggaaccatttttgattcccactctgggggtttttgggggcct
gagttaaagtttgctgggtatgacgcggcaatcatagagggtaaagctgagaccccggtc
tatatctggataaacgatgggggtgtggagattcgtggcgcctctgaggtctgggggctg
gacacccacatgacaacggaaagattgatcaaagaaacagatccaaaggcaaaggttgcc
tgtataggcccagctggtgagagacaggtctcgcttgccgcgataataaatgataggcat
agggccgcgggccgcggcggacttggagccgtgatgggctccaagaatctcaaagccgtt
gtggtgagaggaacatgtagggttgatgtcgctgatgaaggagggttcagcgaagccctt
gatgagagtttgatggtgattagaaaaaatccaattaccgacaagtcccttccaacgttg
ggcaccgctgtcttggtgaatctcataaatgagcatggaatgtatccgacgagaaatttt
caagaaggggtgtttgaggatgctgaggggataagtggagagaaaatagccgagacaatc
ctcaatggaaggcgagcatgctacgcctgccccatagcatgtggcagaatcacaaaaacc
tctgagaaagagggggagggtcccgaatatgagactgcctgggccttcagcgctcagtgc
gggataaacgatctcacccaagtaacgcacgcaaattacctttgcaacgaacttggccta
gacaccatctcgactggcaacacaatagggtgcgccatggagatgtctcaaaagggattt
ttaagagagaaaatagaatttggcgatgctgacaaactagttgagttggtgaagaaaata
gcgctgagagaagggattggaaaagagcttggggaggggtcaaagcgtttggcagaaaga
cacggctgtccagagctcgcaatgcaggttaaggggttggaactaccagcctatgaccct
aggggagcgcagggacacgcactagcttacgctacgtctaatagaggtggctgtcatctt
cgtgcctatctgatcggcccagaaatactgggcacccccgccttggttgacagattcagg
ccagatgggaaggctgacctggtcataacctatcaaaatctatttgcagccttggattcc
atgatactctgcgtgttcacctcattcgcgttaagcccagaccactatgcgaagttcacc
tcagcagttacgggtctcagattcgcagacgaggacgtaatgaaaatcggagagcgaata
tggaacctggaaaggctgtttaacatgagggagggatttgggaagaaggatgatacactt
ccgctgagatttcttaagacgccacttcctgaaggaggctccaggggaagaagagtgttg
ctggataagatgttgaaggaatactatgatttaagaggatgggatggtgaagggtttccc
ctaaaaagtaagttaaaagagttaggcttaagttga

DBGET integrated database retrieval system