KEGG   Bartonella sp. JB63: BJB63x_000090Help
Entry
BJB63x_000090     CDS       T05552                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
barj  Bartonella sp. JB63
Pathway
barj00061  Fatty acid biosynthesis
barj00780  Biotin metabolism
barj01100  Metabolic pathways
barj01130  Biosynthesis of antibiotics
barj01212  Fatty acid metabolism
Module
barj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:barj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BJB63x_000090
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BJB63x_000090
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BJB63x_000090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:barj01004]
    BJB63x_000090
Enzymes [BR:barj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BJB63x_000090
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BJB63x_000090
Lipid biosynthesis proteins [BR:barj01004]
 Fatty acid synthase
  Component type
   BJB63x_000090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AQX28713
LinkDB All DBs
Position
complement(9652..10491)
Genome map
AA seq 279 aa AA seqDB search
MKGLMKGKRGLIMGIANDHSIAWGIACQLANAGAELALTYQGEAFGKRVQPLAEKLGCKL
SLECDVEKIENVNRIFEYLEKEWKTIDFVVHAIGFSDKTQLKGRYVDVTTRENFNRTMVI
SAYSFTEVAQCAGKLMPNGGALLTLTYGASQRVVPNYNIMGIAKAALEAMVRYLASDFGP
QNIRVNAISAGPIRTLAGNGIASARAIFSYQRRNAPLRRTVNINEIGNAALYLLSDLSSG
VTGEIHYVDSGYNILSMPTLEELKQSEEAQENKNSYNKK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtttgatgaagggcaaacgtggtcttattatggggattgcaaatgaccattcg
attgcttggggtattgcgtgtcaattagcaaacgcaggagctgaattagcactgacatat
caaggagaagcttttgggaaacgtgtccagccactagcagagaaacttggctgtaaatta
tcattagaatgtgatgttgaaaaaattgaaaatgtcaatcgcatttttgagtatcttgaa
aaagaatggaaaactattgattttgttgttcatgctattggtttttcagataaaacgcaa
ttaaaggggcgttacgttgacgttacaacacgtgaaaatttcaatcgcacaatggttatt
tcagcctattcctttactgaagttgctcaatgcgcgggtaaactcatgcctaatggtggt
gcattattaacacttacttatggggcttcacaaagagttgttcctaattacaatattatg
ggcatagctaaagcagctttagaagctatggtacgctatttagcctcagattttgggccc
caaaatattcgtgtcaacgcaatttcagctggccctattcggactttagctggcaatggc
attgcatctgcgcgagcaatcttttcatatcaacgccgtaatgcacctctacgtcgcact
gtaaatattaatgaaattggaaatgccgctctttacttgctctcggatttatcatcaggt
gttacaggtgaaattcactatgttgattcaggttacaatatcctatctatgccaacactt
gaagaactaaaacaaagcgaagaagctcaagaaaataaaaactcatacaataaaaaatag

DBGET integrated database retrieval system