KEGG   Bartonella sp. JB63: BJB63x_010440Help
Entry
BJB63x_010440     CDS       T05552                                 

Definition
(GenBank) twinkle protein
  KO
K17680  twinkle protein [EC:3.6.4.12]
Organism
barj  Bartonella sp. JB63
Brite
KEGG Orthology (KO) [BR:barj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:barj03029]
    BJB63x_010440
Enzymes [BR:barj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BJB63x_010440
Mitochondrial biogenesis [BR:barj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    BJB63x_010440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_2 Toprim_4 DnaB_C AAA_25 Toprim Toprim_3 DUF3854
Motif
Other DBs
NCBI-ProteinID: AQX29698
LinkDB All DBs
Position
1176274..1178190
Genome map
AA seq 638 aa AA seqDB search
MSTLFEIKQRLTAQAGSIAEMLLPQGRKQGNSWVVGNIRGEAGQSLSISLSGSKAGLWYD
FAEGSGGDLLDLWCGVKGISLSQALDEARAYLNLSRPKPFMAPRHQYRSPSIPKANMPQH
QVKTYLHKKRHIPLEILQRYQIGEEGNKIIFPFYKPNGTLALVKERLAEDGAKAKPTLSQ
CEPILFGWQALSSKERASTDRTLVITEGEIDALSLATYGYPAVSVPFGGGKGGKQNWIEN
EFDHLESFETIFLATDMDASGEEAAFEIAHRLGRHRCYRVQLPGKDANACLQAGVDASII
QEAFLQAQSFTPKGLRHALDYKEQVINLFYPPAEQHLGYTIPYPQLNGKLYFRPAELTLW
SGASGAGKSQLLSDCIPHWIEQKSRLCLASLEMKGEQSLRRLTKQTGGTDQPTKEMIERI
LHFLDAGLILYEHVGKSSVDTLLDVFDYCRAKYGCDQFIIDSLMRLGISSDDYAGQEKAV
YKIVDWAILNAVHIHLVAHTRKSGLEKDIPGTEDIKGASEIGANAFNIITIWRNRSLEDK
IFSAHQPEEKANLTQRPGVIMNIAKQRSGDFEGKIGLWFDPKTYRYRCSSSASSTLRRYI
ERDHNSSLKPKESYPSPHILHHFPTSPPPQESPSFSPP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgagcacactttttgaaattaaacaaagactaactgcccaagcgggttctattgcagaa
atgcttcttccacaaggtcgcaaacagggcaattcctgggttgttgggaatatccgcggt
gaagcaggacaaagcctatcaatcagcttaagcggtagtaaagcaggtctttggtatgat
tttgctgaaggcagcggcggcgatcttcttgacctatggtgtggtgttaaagggatcagc
ctttcccaagcacttgatgaagcgcgcgcttatctcaatctttctcgtcccaagcctttt
atggctccccgccatcagtatcgttcaccctctattcccaaagccaacatgcctcaacat
caggttaaaacatatttgcacaaaaagcgtcatattccacttgaaattttacaacgatac
caaattggagaagagggcaataaaattatttttcctttttataagccaaatggcaccctt
gctctagtgaaagagcgcttagccgaagacggtgcaaaggcaaaaccgactctttctcag
tgtgagccgattctctttggctggcaagctttgtcctccaaagaacgtgcttcaacggat
cgaaccctggttatcaccgaaggagagattgacgctctttctttagcgacctatggctat
ccagctgtttcagttccctttggcggaggaaaggggggcaaacaaaattggattgagaat
gaatttgatcatttagaatcctttgaaaccatttttttagccacagatatggatgcatcg
ggggaagaagcagcttttgagattgctcatcgccttggtcgtcatcgttgttatcgcgtc
cagcttcctggcaaagatgcgaacgcgtgtttacaagcaggtgttgacgcttccattatc
caagaagcttttttacaggctcaaagctttacgccaaaggggttacgtcatgctttggat
tataaagagcaagtaatcaacttattttatcctcctgcagaacagcatcttggctatacg
attccctatccccaattgaatggtaagctttattttcgccctgcagaattgaccctgtgg
agtggggccagtggtgcaggtaaaagtcaacttttatcagattgcattccccattggatt
gagcaaaaaagccgtctttgcttagcttctcttgaaatgaaaggcgaacaatctttgcgt
cgtttaacgaagcaaacgggtggaaccgaccaaccaacgaaagaaatgattgaacgtatt
cttcattttttagatgcaggtcttattctgtatgaacatgtaggcaaatcaagcgttgac
actttactagatgtttttgactattgccgtgcaaaatatggctgtgaccagtttattatt
gacagtctgatgcgtcttgggatctcttctgatgactatgctgggcaagaaaaagctgtt
tacaaaatcgttgattgggctatcttaaacgctgttcacattcatcttgtagcgcatacg
cgcaaaagtggtttagaaaaggatattcccggcacagaagacattaaaggcgcctcagaa
attggtgcaaatgcttttaatattatcaccatttggcgtaatcggtctttagaagataaa
attttttccgctcatcaaccagaagaaaaagcaaacttaacgcaacgtccaggtgtcatt
atgaatatcgccaaacaacgctctggtgattttgaagggaaaatcggtctctggtttgac
cccaaaacttaccgttatcgttgttcttcttctgcttcatcgactctgcgacgctatatt
gaacgcgaccacaacagttctttgaaaccaaaagaaagctatccctcccctcacatattg
catcatttccctacatctcctccaccacaagaatctccttctttttcccctccatga

DBGET integrated database retrieval system