KEGG   Bartonella sp. 1-1C: B11Cv2_002920Help
Entry
B11Cv2_002920     CDS       T05463                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro00473  D-Alanine metabolism
baro00550  Peptidoglycan biosynthesis
baro01100  Metabolic pathways
baro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:baro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B11Cv2_002920
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B11Cv2_002920
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B11Cv2_002920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:baro01011]
    B11Cv2_002920
Enzymes [BR:baro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B11Cv2_002920
Peptidoglycan biosynthesis and degradation proteins [BR:baro01011]
 Precursor biosynthesis
  Amino acid ligase
   B11Cv2_002920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ATO57075
UniProt: E6YWB0
LinkDB All DBs
Position
352150..353070
Genome map
AA seq 306 aa AA seqDB search
MRGKHIAVLMGGLSSERSVSLSSGSACADVLEAHGYSVTRVDVDSRIASILEKLQPHIAF
NALHGSFGEDGRIQGILEYLKIPYTHSGVMASALAMDKGRAKIIAASAGVPVAPSYVMDR
CAIGSQHPLEPPYVIKPVHEGSSVGVIIVNGDEAFPPHNIASSERMDKDEVIVEKYIPGR
ELTCAVLGDEVLDVCEIIPDQHFQFYDYDSKYKSGGSIHICPAQLSLNIYQKVQRMSLVA
HQAIGCRGVSRSDFRFNEETEELIWLEINTQPGMTSTSLVPDIAKASGRTYSDIVKWIVE
DASCMR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtaagcatatagctgtattgatgggagggctttcatcagaacgttctgtaagt
ttatcttctggttctgcttgtgctgatgttcttgaagctcatggttattctgtaactcgt
gtagatgttgatagtcgtattgcttctattcttgagaaattacaaccacatatagctttt
aatgcattacatggttcgtttggtgaagatggacgtattcaaggcattcttgaatatttg
aaaattccttatacgcattctggagtgatggcgtcagcattagcaatggataaagggcgg
gcaaaaattattgctgctagtgctggtgttcctgttgctccttcttatgtaatggatcgt
tgtgcgattggatcacaacatcctttggaaccgccttatgtaattaaacctgtgcatgaa
ggatcaagcgttggtgttattattgtgaatggcgatgaagcatttccacctcataatatc
gcaagctctgagcggatggataaagatgaggtaatcgttgaaaagtatattcctggtcgg
gaacttacttgcgctgttttgggtgatgaagttttagatgtctgtgagattatacctgat
caacatttccagttttatgattatgattcaaaatacaagtccggtggttctattcacatt
tgtcctgcacaactttcattaaatatttaccaaaaagtgcaaagaatgtctttagtagca
catcaagcgataggttgtcgaggtgttagtcgttctgattttcgttttaatgaagaaacg
gaagagctaatttggctcgaaattaatacgcagcctggtatgacatcaacctctcttgtg
ccagatattgcaaaagcaagtggtcgtacttatagcgacattgttaaatggatagtggag
gacgcgtcatgtatgcgttaa

DBGET integrated database retrieval system