KEGG   Bartonella sp. 1-1C: B11Cv2_004150Help
Entry
B11Cv2_004150     CDS       T05463                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
baro  Bartonella sp. 1-1C
Brite
KEGG Orthology (KO) [BR:baro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:baro03012]
    B11Cv2_004150
   03029 Mitochondrial biogenesis [BR:baro03029]
    B11Cv2_004150
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baro04147]
    B11Cv2_004150
Translation factors [BR:baro03012]
 Eukaryotic Type
  Elongation factors
   B11Cv2_004150
 Prokaryotic Type
   B11Cv2_004150
Mitochondrial biogenesis [BR:baro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B11Cv2_004150
Exosome [BR:baro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B11Cv2_004150
  Exosomal proteins of breast cancer cells
   B11Cv2_004150
  Exosomal proteins of colorectal cancer cells
   B11Cv2_004150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ATO57194
UniProt: E6YW03
LinkDB All DBs
Position
465328..466503
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEERARGITIST
AHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDSELLELVELEVRELLSKYDFPGDDIPIVKGSALAALEDSNKS
IGEDSVRLLMSEVDKYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGIIKVGEEI
EIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGVDREGIERGQVLAKPGSVTPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVAMDVSL
IVPIAMEEKLRFAIREGGRTVGAGIVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgaacgtacgaagccgcatgttaatataggtacgattggtcat
gttgatcatgggaagacttcattgacggcagcaattacgaagtattttggtgaatttaaa
gcgtatgaccaaattgatgcggcacctgaggagcgggcccgtggtataacgatatctact
gcgcacgttgagtatgaaacggagagccgtcactatgctcatgttgattgtcctggtcat
gcggattatgttaagaacatgattacaggagcggcccaaatggatggtgccatattagtt
gtttctgcagcagatgggcctatgcctcaaacgcgtgagcatattttgttggcccgtcag
gttggtgttccagcgattgttgtttttctcaataaagttgatcaggttgatgatagcgag
cttttagagcttgtagagcttgaggttcgtgagcttttatcgaaatatgattttccggga
gatgatattcctatagttaagggttcggctttagcggcgcttgaggattcaaataagagt
ataggtgaagattctgttcgtcttttgatgagtgaagttgataaatatataccgacccct
gagcgtccagttgatcagccgtttttgatgcctatcgaggatgttttttctatttctggt
cgtggtacggttgttacgggtcgtgttgagcgtggcattattaaagttggtgaagaaata
gagattattggtattcgtcctacatctaagacaacagttactggggttgaaatgtttcgc
aaacttttagatcaaggccaggctggtgataatataggcgctttgcttcgtggtgttgat
cgtgaagggattgaacgtggtcaagtattggcgaagcctggttctgttacccctcatact
aaatttaaagctgaggcttatattttaacaaaagatgagggggggcgtcacacaccgttt
ttcacgaattatcgtcctcaattttattttcgtacgaccgatgttacgggtatagttacg
cttcctgaaggaacggaaatggttatgccgggtgataatgttgcaatggatgtctctttg
attgttccaatcgcgatggaagagaagcttcgttttgcgatccgagaaggtggtcgcacc
gttggggctggtatcgtatctaaaattattgaataa

DBGET integrated database retrieval system