KEGG   Bartonella sp. 1-1C: B11Cv2_007330Help
Entry
B11Cv2_007330     CDS       T05463                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferasesubunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro00970  Aminoacyl-tRNA biosynthesis
baro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B11Cv2_007330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:baro03029]
    B11Cv2_007330
Enzymes [BR:baro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     B11Cv2_007330
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     B11Cv2_007330
Mitochondrial biogenesis [BR:baro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B11Cv2_007330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ATO57496
UniProt: E6YV68
LinkDB All DBs
Position
complement(809540..811039)
Genome map
AA seq 499 aa AA seqDB search
MEIVDTRLPDPKRFISGTTGDWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNNHVSLVD
AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG
EGKVVVSTGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS
KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEVKNV
NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDATKGETRSMRSKEEAYDYRYFPDPD
LLPLELDQVFVDTLASELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR
DGKMVANWVINDLLGALNKDNRDIEDTPITANQLGAIIDLIKDGTISGKIAKDLFEIIWN
EGGDPHQIVEKRGMKQVTDAGVIERVVDEIIINNPDKVSQAREKPALIGWFVGQVMKATE
GKANPQTVNKLVKSKLGVD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgatactcgtcttcctgatcctaagcgttttatttctggaactacaggt
gattgggaagttattattggcatggaagttcatgcgcaagtcatatcaaattcaaaactt
ttttcaggtgcatcaactaagtttggggctgagccgaataatcacgtgtcacttgttgat
gcagctatgcctggtatgttgcctgttattaatcaagcatgtattcgtcaagctgttcga
actggtttagggttaaaagctaaaattaatttaaaatctgtttttgatcgtaaaaactat
ttttatccagatttaccccaggggtatcagatttcacagtttcagtatcctatcgtaggt
gaagggaaagtagttgtatctactggaccagattcgaatggtcagtttgaggatattgaa
attgggattgaaaggttgcaccttgagcaagatgctggaaagtctatgcatgaccagcat
ccaacaatgtcttttgtagatcttaatcgctcaggtgttgctcttatggaaattgtttct
aaaccagatatgcgatcatcagaagaagcaaaagcctatatgacaaaattacgtacaatt
gttcgttatttgggtacttgtgatgggaatatggatgagggctctatgcgtgcagatgta
aatatatctgttcgccgtcctggtggaccttttggaacgcgctgtgaagttaaaaatgtt
aattcgattcgttttattggccaagcaattgaatatgaggcacgtcgccaaattgcaatt
ttagaagatgggggtgtaatagatcaggaaactcgactttttgatgcaacaaaaggtgaa
acaagatctatgcgttcaaaagaggaagcatatgactatcgttattttcctgatcctgat
cttttaccgttagagcttgatcaggtttttgtagatactttagcttcagaattacctgaa
ttacctgatgatataaaggcgcgttttatcaatgagatggggttaaccgcatatgatgct
tctattcttgtaacagaaaaagcaattgcagattattttgaagaagtagcacatgggcgg
gatggaaagatggttgctaattgggtgattaatgatcttttaggcgctttaaataaagat
aatcgtgatattgaagatactccaattacagcaaaccaattgggagcaattattgatctt
atcaaagatggaactatttctggaaaaattgcaaaagatctatttgaaattatttggaat
gaaggtggagatccacatcagattgtagaaaagcgtggtatgaagcaggtaacggatgca
ggagttattgaaagagttgttgacgaaattattatcaataaccctgataaagtttctcaa
gcacgggagaagcctgctttgattggttggtttgttggacaggtaatgaaggcaacagaa
ggtaaggcaaatcctcaaacagttaataaattagttaaaagtaagcttggggtagattaa

DBGET integrated database retrieval system