KEGG   Bartonella sp. 1-1C: B11Cv2_012220Help
Entry
B11Cv2_012220     CDS       T05463                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro00020  Citrate cycle (TCA cycle)
baro00190  Oxidative phosphorylation
baro00650  Butanoate metabolism
baro01100  Metabolic pathways
baro01110  Biosynthesis of secondary metabolites
baro01120  Microbial metabolism in diverse environments
baro01130  Biosynthesis of antibiotics
baro01200  Carbon metabolism
Module
baro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
baro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
baro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:baro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B11Cv2_012220
   00650 Butanoate metabolism
    B11Cv2_012220
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B11Cv2_012220
Enzymes [BR:baro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B11Cv2_012220
    1.3.5.4  fumarate reductase (quinol)
     B11Cv2_012220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: ATO57960
UniProt: E6YX50
LinkDB All DBs
Position
complement(1364270..1365049)
Genome map
AA seq 259 aa AA seqDB search
MVQIRLPKNSQVKTGKVWPKPEGATHLTEFHIYRWSPDDEKNPHLDTYYVDRSLCGPMIL
DGLLFIKNHIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMDDVKHPIKVYPLPSMP
IVKDLVPDLKRFYAQHRAIDPWLKTVSPKPAKEWLQSYSDRQKIDGLYECILCACCQTSC
PSYWWNGDRYLGPAVLLQAYRWIIDSRDEMSGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKLMVERRL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaattaggcttcccaaaaattctcaagttaaaactggaaaagtttggcctaaa
cctgaaggtgctacgcatttaacagaatttcatatttaccgttggtcacctgatgatgag
aagaatccgcatcttgatacttattacgtggatcgttcactgtgtggtccgatgattctt
gatgggcttttatttattaagaatcatattgatccaactttgacacttcgtcggtcatgc
cgtgagggcatttgtggttcatgtgcgatgaatattgatggaaccaatacattggcttgt
actaaaggaatggatgatgtaaaacatccaattaaagtgtatccacttccttctatgcct
attgtaaaagatttggttcctgatttaaagcgtttttatgcacaacatcgtgctattgat
ccttggctaaaaactgtttctcctaaacctgcaaaagaatggttacaaagctattctgat
cgtcagaaaattgatggtctttatgagtgtatcctttgtgcatgctgtcaaacgtcgtgc
ccaagttattggtggaatggtgatcgttatttaggacctgctgttttactccaagcttat
cgctggattattgattctcgtgatgaaatgagtggtgagcgtcttgataatttagaagat
ccttttcggctttatcggtgccacacgattatgaattgtgcgcaaacttgtccgaaaggt
ttaaatccagctaaggcgattgctgaaattaaaaaacttatggttgaacgacgtctttga

DBGET integrated database retrieval system