KEGG   Bartonella sp. Raccoon60: Bra60_002950Help
Entry
Bra60_002950      CDS       T05326                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
barr  Bartonella sp. Raccoon60
Pathway
barr00471  D-Glutamine and D-glutamate metabolism
barr00550  Peptidoglycan biosynthesis
barr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:barr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bra60_002950
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bra60_002950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:barr01011]
    Bra60_002950
Enzymes [BR:barr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Bra60_002950
Peptidoglycan biosynthesis and degradation proteins [BR:barr01011]
 Precursor biosynthesis
  Amino acid ligase
   Bra60_002950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AQX26316
LinkDB All DBs
Position
342368..343795
Genome map
AA seq 475 aa AA seqDB search
MKMPLNIGLIHFVGIGGIGMSGIAEVLHNLGYKVQGSDQTYNANVERLQNKGINICIGHR
AENLGAAEVVIISTAIKKTNPEYIAAQKRHLPVVKRAEMLAELMRFRRTIAIGGTHGKTT
TTSMVAALLDAGHFDPIVINGGIINAYGTNARMGDGDWMVVEADESDGTFLKLPADIAVV
TNIDVEHLDHYGNFNAIREAFRQFVENVPFYGFAVMCIDHPEVQTLASRIHDRWVITYGA
NPQADIRFLNLSMEGQKACFDILIRSRKTGEKTEINNLILPMSGKHNVSNATAAIAIAHE
LGISPEAIKKGLAEFGGVKRRFTKTGNWNGVEIFDDYGHHPVEIKAVLHAARESAKGNII
AIMQPHRYTRLYHLFDDFSTCFNDADTVMITPVYAAGEEPIAGFGSKELVEHIQMAGHRD
VHLINSLEDIISIVSRLAKSGDYVVFLGAGSITQWAYALPDQLMVLDNNDKFSAD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgccgcttaatattggccttatccactttgtaggaattggaggtataggtatg
agcggaattgctgaagttcttcataatcttggttataaagttcaaggatctgatcaaact
tataacgcaaatgttgaacgcttacagaataagggaattaatatttgtataggacatcgt
gctgaaaatttaggagcagcggaagttgttattatttctactgctattaagaaaacaaat
cctgaatatattgctgcccaaaaaaggcatttaccagttgttaagcgagcagaaatgctt
gctgagttaatgcgttttcgtcggacaattgctattggtggtacgcacggaaaaacaaca
actacgtcaatggtagctgcacttcttgatgcaggtcattttgatccgatagtcattaat
ggcggtattataaatgcttacgggactaatgcacgtatgggagatggggattggatggtg
gttgaggctgatgaaagtgatgggacgtttttaaaattgccagctgatatagcagttgtt
accaatatcgatgttgagcatttagaccattatggcaattttaatgctatacgtgaagct
tttcggcagtttgtagaaaatgtgcctttttatggttttgccgttatgtgtattgaccac
ccagaagttcagacattagctagtcgtattcatgatcgttgggtgattacgtatggcgca
aatccacaagcagatattcgttttcttaatctttcaatggagggtcaaaaagcgtgtttc
gatattcttattcgatcacgaaaaacaggtgaaaaaactgaaatcaacaatttgattttg
ccgatgtcggggaagcataatgtttctaatgctactgcagcaattgctattgcacatgaa
ctcggcatttcacctgaagctataaagaaaggattagcagagtttggtggtgttaaacgg
cgttttacgaaaacagggaattggaacggagttgagatatttgatgattacgggcatcat
ccagttgaaataaaagcagttttgcatgcagcacgtgagagcgcaaaaggaaatatcatt
gcgattatgcaaccacatcgttatacgcgcttgtatcatctatttgatgatttttctact
tgttttaatgatgcggatacagtgatgattacaccggtttatgcagctggtgaagagcca
atagctggttttggttctaaagaattagttgagcatattcagatggctggccaccgtgat
gtgcatctgattaatagtttagaagatattatttctattgtatctaggttagctaaatct
ggtgattatgtggtttttctgggtgctggtagcatcacacaatgggcttacgcactgccc
gatcaattaatggtacttgataacaatgacaaattttcggccgattga

DBGET integrated database retrieval system