KEGG   Bartonella sp. JB15: BJB15x_006380Help
Entry
BJB15x_006380     CDS       T05113                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferasesubunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bart  Bartonella sp. JB15
Pathway
bart00970  Aminoacyl-tRNA biosynthesis
bart01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bart00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJB15x_006380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bart03029]
    BJB15x_006380
Enzymes [BR:bart01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BJB15x_006380
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BJB15x_006380
Mitochondrial biogenesis [BR:bart03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BJB15x_006380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AQX28041
UniProt: A0A1S6XHE4
LinkDB All DBs
Position
complement(711105..712589)
Genome map
AA seq 494 aa AA seqDB search
MTDLTTLTIAQARDVLKKGDLKAVELTEAYLKAIKLANPILNAYVTVTEEQARKMAAESD
VRLAKGEAGALEGIPLGIKDLFATQDIHTQACSYILDGFKPKYESTVTANLWKDGAVMLG
KLNMDEFAMGSSNETSCYGPTINPWRKKESDERLVPGGSSGGSAAAVAAHICAGATATDT
GGSIRQPAAFTGTVGIKPTYGRCSRWGMIAYASSLDQAGPVGRDVRDCAIMLKSMASFDD
KDSTSVNLPVPDYEHYLGQSIKGMKIGIPKEYYIEGMSNEIVDLWQKGINWLKEAGAKII
DISLPHTKYALPAYYIVAPAEASSNLARYDGVRFGLRVPGKDVIEMYENTRSVGFGDEVK
RRILIGTYVLSAGYYDAYYLKAQRVRTLIKRDFDYCFSLGIDAILTPATPTPAFDIADKK
IKNDTIAMYLNDIFTVPVNMAGLPGISVPAGLSLNGLPLGLQLIGRSFSEEVIFKIAYII
EQAAGILNAEKWWL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttaacaaccttaacaattgcgcaagcccgtgacgttttaaaaaagggagat
ttgaaggcagttgaattgacagaagcttatttgaaagcgattaaattagctaatccaatt
ctgaacgcttatgtaacagtaactgaagaacaagcaagaaaaatggcagctgaatcagat
gttcgcttggctaaaggggaagctggtgctttagaaggtattccattagggattaaagat
ctttttgcaacgcaagatatacatactcaggcttgctcatatattcttgatggttttaag
ccgaaatatgaatcaactgtaactgctaatttatggaaagatggtgcagttatgttgggc
aagctgaatatggatgagtttgctatggggtcatccaatgaaacatcatgttatggtcca
actattaatccatggcgaaaaaaagaatcagatgaaaggcttgttcctggtggttcttca
ggaggttctgctgctgctgttgcagctcatatttgtgctggagcaacagcaaccgatacc
ggtggatcaatacgtcagccagcagcttttactggtactgtaggaataaagccaacttat
gggaggtgttcgcgttggggaatgatagcttatgcttcatcacttgatcaggcagggcct
gttgggcgagatgttcgtgattgtgcaattatgttaaaatcaatggcttcttttgatgat
aaagattcaacttcagttaatttaccagtacctgattatgaacattatcttggtcaatca
atcaaaggcatgaaaattggtatcccaaaggaatattacattgaaggaatgtctaatgag
attgttgacctttggcaaaaaggaattaattggctaaaagaggcaggagcaaaaatcatt
gatatttcattacctcatacaaaatatgctttacctgcttattatattgtagctcctgca
gaagcatcttctaatttagcccgttatgatggtgttcgttttgggcttcgtgtaccagga
aaagatgttattgaaatgtatgaaaacactcgttcagttggctttggtgatgaggttaag
cggcgtattctgattggaacttatgttctttcagcaggatattatgatgcttattatctt
aaagctcagagagtacgaacattaattaaacgtgatttcgattattgttttagtcttggt
atcgatgctattctaacccctgcaacaccgactcctgcttttgatattgcggataaaaaa
ataaagaatgatacaatagctatgtatcttaatgatatttttactgtgccagttaatatg
gctggcttgccaggaatttctgtccccgcaggtttatcattaaatggtttgcctttagga
ttacaattgataggtagatctttttctgaggaagttatttttaaaatagcatatattata
gaacaggcagcaggaatattaaatgctgaaaaatggtggctataa

DBGET integrated database retrieval system