KEGG   Bartonella sp. JB15: BJB15x_007550Help
Entry
BJB15x_007550     CDS       T05113                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bart  Bartonella sp. JB15
Brite
KEGG Orthology (KO) [BR:bart00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bart03012]
    BJB15x_007550
   03029 Mitochondrial biogenesis [BR:bart03029]
    BJB15x_007550
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bart04147]
    BJB15x_007550
Translation factors [BR:bart03012]
 Eukaryotic Type
  Elongation factors
   BJB15x_007550
 Prokaryotic Type
   BJB15x_007550
Mitochondrial biogenesis [BR:bart03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BJB15x_007550
Exosome [BR:bart04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BJB15x_007550
  Exosomal proteins of breast cancer cells
   BJB15x_007550
  Exosomal proteins of colorectal cancer cells
   BJB15x_007550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AQX28152
UniProt: A0A1S6XHZ7
LinkDB All DBs
Position
complement(836147..837322)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEERARGITIST
AHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDIPIVKGSALAALEDSNKS
IGEDSVRLLMSEIDKYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGVIKVGEEI
EIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGVDREGIERGQVLAKPGSVTPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVAMDVSL
IAPIAMEEKLRFAIREGGRTVGAGIVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgaacgtacgaagccacatgttaatataggtacgattggtcac
gttgatcatggaaagacttcattgacggcagcgattacgaagtattttggtgaatttaaa
gcatatgatcaaattgatgcggcacctgaggagcgtgctcgtggtataacgatatctact
gcgcatgttgagtatgaaacggagagccgtcactatgcgcatgttgattgtcctggtcat
gctgattatgttaagaacatgattacaggtgctgcgcaaatggacggagccatattggtt
gtttctgcggcggatggtcctatgcctcagacgcgagagcatattttgttggcgcgtcag
gttggtgttccagcgattgttgtttttctgaataaagttgatcaggttgatgatgcagag
cttttagagcttgttgagcttgaggttcgagagcttttatcgaaatatgattttcctgga
gacgatattcctatagttaaggggtcagctttagcagcgcttgaggattctaataagagt
ataggggaagattctgttcgtcttttgatgagtgaaattgataaatatataccgacgcct
gagcgtccagttgatcaaccgtttttgatgcctattgaggatgtattttctatatctggt
cgtggtacggttgttacgggtcgtgttgagcgtggtgttattaaagttggtgaagaaata
gagattatcggtatccgtcctacatctaagacaacagttactggggttgaaatgtttcgt
aaacttttggatcaaggtcaggctggtgataatattggagctttgcttcgtggtgttgat
cgagaagggattgagcgtggtcaggttttggcgaagcctggttctgttacgccgcatact
aagtttaaagctgaagcctatattttaacgaaagatgaagggggtcgtcatacaccgttt
ttcacgaattatcgtcctcagttttattttcgtacaacagatgttaccggtatagttacg
ttgccagagggaacggaaatggttatgccaggtgataatgttgctatggatgtttctttg
attgcgcctattgcaatggaagagaagctccgtttcgcaatccgagaaggtggccgtacc
gttggtgctggtatcgtatctaaaatcattgaataa

DBGET integrated database retrieval system