KEGG   Bartonella sp. WD16.2: BWD162_004110Help
Entry
BWD162_004110     CDS       T05203                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
barw  Bartonella sp. WD16.2
Brite
KEGG Orthology (KO) [BR:barw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:barw03012]
    BWD162_004110
   03029 Mitochondrial biogenesis [BR:barw03029]
    BWD162_004110
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:barw04147]
    BWD162_004110
Translation factors [BR:barw03012]
 Eukaryotic Type
  Elongation factors
   BWD162_004110
 Prokaryotic Type
   BWD162_004110
Mitochondrial biogenesis [BR:barw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BWD162_004110
Exosome [BR:barw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BWD162_004110
  Exosomal proteins of breast cancer cells
   BWD162_004110
  Exosomal proteins of colorectal cancer cells
   BWD162_004110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AQX19540
UniProt: A0A1S6WTC0
LinkDB All DBs
Position
520572..521747
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEERARGITIST
AHVEYETEQRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDIPIVKGSALAALEDSDKS
IGEDAVRRLMSEVDNYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIIKVGEEI
EIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGIDREGIERGQVLAKPGSVTPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVAMDVSL
IVPIAMEEKLRFAIREGGRTVGAGIVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgaacgtacgaagccgcatgttaatataggaacgataggtcac
gttgaccatgggaagacgtccttgacagcggcgattacgaaatattttggtgaatttaaa
gcgtatgaccaaattgatgcggcgcctgaggagcgtgcccgtggaattaccatttcaaca
gcgcatgttgagtacgaaacagaacaacgtcactatgcgcatgttgattgtccaggtcac
gcggattatgtgaagaacatgatcacaggtgcagcacagatggatggagcgattttggtt
gtttcagcagctgatggaccgatgcctcagacacgtgagcatattttgctagcacgtcag
gttggtgttcctgcgattgtggtttttctaaataaggttgatcaggttgatgatgctgag
cttttagagcttgttgagcttgaagttcgggaacttctttcgaaatatgacttccctggt
gatgatataccgatagttaaaggttctgcgttagcggctcttgaggattcagataaaagt
ataggtgaggatgcagttcgtcgtttgatgagcgaagttgataattatattccaacgcct
gagcgtccaattgatcagccgtttttgatgcctatagaggatgttttttcaatatctggg
cgtggaacggttgtaacgggtcgtgttgagcgtggaattattaaagttggtgaagaaatc
gagattataggtattcgtccgacttctaagacgacggttacgggtgttgaaatgttccgt
aagcttttagatcaaggtcaggcaggtgataatataggtgcattgcttcgtggtattgat
cgtgaggggattgaacgtggacaagttttggcgaagcctggttctgttacaccacatacc
aagtttaaagctgaggcttatattttgacgaaagatgagggtggtcgtcatacaccgttt
tttacaaattatcgtccacagttttatttccgcacgacggatgtgacaggaattgttaca
cttccagaaggtacggaaatggttatgccaggtgataatgttgcaatggatgtttctttg
attgttccaattgcaatggaagagaagcttcgtttcgctatccgtgaaggagggcgtact
gtcggagctggtatcgtttctaagattattgaataa

DBGET integrated database retrieval system