KEGG   Bartonella sp. WD16.2: BWD162_004400Help
Entry
BWD162_004400     CDS       T05203                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
barw  Bartonella sp. WD16.2
Pathway
barw00061  Fatty acid biosynthesis
barw00780  Biotin metabolism
barw01100  Metabolic pathways
barw01212  Fatty acid metabolism
Module
barw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:barw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BWD162_004400
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BWD162_004400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:barw01004]
    BWD162_004400
Enzymes [BR:barw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BWD162_004400
Lipid biosynthesis proteins [BR:barw01004]
 Fatty acid synthase
  Component type
   BWD162_004400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AQX19568
UniProt: A0A1S6WTD7
LinkDB All DBs
Position
554429..554908
Genome map
AA seq 159 aa AA seqDB search
MINTGEIKSLETVDIDKLLSILPHRYPFLLIDRIIEIDGDQKAIGIKNVTINEPYFMGHF
PEKPVMPGVLILEAMAQTAGAISLLKLDDKKTGLVYLMTVDNAKFRKPVVPGDQLKLHVQ
LLKKRSGVRRFSCVAEVEGICVSEAEVSAMIVESEQTVK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacacgggagagatcaaaagtctagaaactgtagatattgataaattattgtca
atactaccgcatcgttatccgtttctgttgattgatcgtatcattgaaattgatggcgat
caaaaagctattggtattaaaaatgtgacaattaatgaaccctattttatggggcatttt
cctgaaaaaccagttatgcctggtgtgttaattttagaagctatggcgcagacagcagga
gctatttcacttttaaaattagatgataaaaaaacaggcttagtttaccttatgactgtt
gataatgcaaaatttcgtaaaccagttgtacctggtgatcaattaaagcttcatgttcaa
ctgttaaaaaagcgatccggtgttagacgtttttcatgtgttgcagaagtagagggtatt
tgcgtttctgaagcggaagtttctgcaatgattgtcgaatcagagcaaacagtgaaatag

DBGET integrated database retrieval system