KEGG   Bartonella sp. WD16.2: BWD162_005700Help
Entry
BWD162_005700     CDS       T05203                                 

Definition
(GenBank) biotin carboxylase/acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
barw  Bartonella sp. WD16.2
Pathway
barw00061  Fatty acid biosynthesis
barw00620  Pyruvate metabolism
barw00640  Propanoate metabolism
barw01100  Metabolic pathways
barw01110  Biosynthesis of secondary metabolites
barw01120  Microbial metabolism in diverse environments
barw01130  Biosynthesis of antibiotics
barw01200  Carbon metabolism
barw01212  Fatty acid metabolism
Module
barw_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:barw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWD162_005700
   00640 Propanoate metabolism
    BWD162_005700
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BWD162_005700
Enzymes [BR:barw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BWD162_005700
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BWD162_005700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_4 RimK ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AQX19693
UniProt: A0A1S6WTQ7
LinkDB All DBs
Position
complement(678802..680148)
Genome map
AA seq 448 aa AA seqDB search
MIQKILIANRGEIALRILRACKELGIKTVVIHSTADADAMHVRLSDESVCIGPPPSHDSY
LNIHQIISACEITGADAIHPGYGFLSENAKFADILEAHEITFIGPTSAHIRIMGDKIEAK
KTAKNLGIPIVPGSDGAVTDEKEALRIINEIGYPVIIKASAGGGGRGMKVVRSEKELSTA
FNTARSEARAAFNDDAVYIEKYLEKPRHIEIQVIGDGAGNAIHLGERDCSLQRRHQKVWE
EAYSPALNELERKKIGSIVANACAKLGYRGAGTIEFLYENGEFYFIEMNTRLQVEHPVTE
AITGIDLVHEQIHIASGQGLSATQDDIRFSGHAIECRINAENPINFTPSPGLITHFHTPG
GLGVRVDSGAYSGYYIPPYYDSLIGKLIVHGRTRLECMMRLRRALDEFVVDGIKTTLPLF
RDLISNQDIIDGNYNIHWLEKYLANKLA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgattcagaaaatcctcattgctaaccgaggagaaatcgctcttcgcatcctacgggct
tgtaaagagcttggaatcaaaactgtagttattcattcaactgctgatgctgatgctatg
catgttcgtctttctgacgaaagtgtttgtattggccctcctccatctcatgactcttat
ttaaatattcaccaaattatttctgcatgtgagattacaggagctgatgctattcatcca
ggatatggttttctttctgaaaatgcaaaatttgcagacattttagaagcccatgaaatt
acatttattggcccaacatctgcgcatattcgcatcatgggtgataaaattgaagcaaaa
aaaaccgctaaaaatcttggaattcctattgtacctggttcagatggagctgtaactgat
gaaaaagaagctctgcgtattattaacgaaatcggttaccctgttattattaaagcttct
gcaggtggtggtggacgcggtatgaaagtcgttcgttctgaaaaagaactttccactgct
ttcaacacagcgcgttcagaagctcgcgccgcatttaatgatgatgcagtttatatcgaa
aaatatttagaaaaaccacgtcacattgaaattcaagttataggtgatggagctggcaat
gctattcatttaggagaacgtgattgttcacttcaacggcgccatcaaaaagtatgggaa
gaagcctactcacctgcccttaatgaacttgaacgaaaaaaaattggttctattgttgcg
aatgcctgtgcaaaacttggttatcgtggagcaggtactattgaatttctttatgaaaat
ggagagttctattttattgaaatgaatacccgtttacaggttgaacatcctgtaactgaa
gcaattacaggtatagatttagttcatgaacaaattcatattgcatctggacaagggctt
tcagccacacaagatgatattcgtttttctggccatgctattgaatgccgtattaatgct
gaaaatccaattaactttacgccatcaccagggcttatcacacattttcatacacctgga
ggtttaggggtgcgtgtcgattcaggtgcttattcaggttattatattccaccttattat
gacagcttaattggaaagctaattgttcatgggcgtacacgcttagagtgtatgatgcgt
ttacgccgtgctttagatgaatttgtggttgatggaattaaaactacgttacctttattt
cgcgatcttatcagtaaccaagatattattgatggcaattataatattcactggttagaa
aaatatcttgctaataaattagcttga

DBGET integrated database retrieval system