KEGG   Bartonella sp. WD16.2: BWD162_009180Help
Entry
BWD162_009180     CDS       T05203                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
barw  Bartonella sp. WD16.2
Pathway
barw00473  D-Alanine metabolism
barw00550  Peptidoglycan biosynthesis
barw01100  Metabolic pathways
barw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:barw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BWD162_009180
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BWD162_009180
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BWD162_009180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:barw01011]
    BWD162_009180
Enzymes [BR:barw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BWD162_009180
Peptidoglycan biosynthesis and degradation proteins [BR:barw01011]
 Precursor biosynthesis
  Amino acid ligase
   BWD162_009180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AQX20029
UniProt: A0A1S6WUQ4
LinkDB All DBs
Position
complement(1018528..1019448)
Genome map
AA seq 306 aa AA seqDB search
MKDRRIAVLMGGFSSERSVSLSSGTACADALEKQGYNVIRVDVDEHIAAVLVQLQPDIVF
NALHGPFGEDGCIQGILEYLKIPYTHSGVMASALAMDKGRAKIIAASASVHVAPSCVMNR
FVIGREHPMEPPYVIKPVREGSSFGVVIVSGDETLPLRNIMSTEWVYGDEVIVEKYIPGR
ELTCAVLGDEVLDVCEIVPDKHFQFYDYDSKYTPGGSLHICPAQLSLNIYQKVQRMSLAA
HQAIGCRGVSRSDFRFVEETEELVWLEINTQPGMTPVSLVPDIAKASGRTYGDIVKWIAE
DASCMR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaggataggcgtatagctgtgttgatgggtggattttcatctgagcgctctgtaagc
ttatcttcaggtactgcttgtgctgatgctcttgaaaagcagggttataatgtaattcgt
gtggatgttgatgaacacattgctgctgttcttgtgcaattacagccagatattgttttt
aatgcattacatggaccgtttggtgaagatggttgtattcaaggtattcttgaatattta
aaaattccttatactcattctggagtgatggcatcagctttggcaatggataaaggacgt
gcgaaaatcattgctgctagcgctagtgtacatgttgctccttcttgtgtgatgaaccgc
tttgtcatagggcgagaacatcctatggagccaccctatgtcattaagccagtgcgtgaa
gggtcaagttttggtgtggtgattgtaagtggtgatgagactttgccattgcgtaatatt
atgagtactgaatgggtttatggagatgaagtgattgttgaaaaatacattcctgggcgt
gaacttacttgcgcagttttaggggatgaggttttggatgtttgtgaaattgtgcctgat
aaacattttcaattttatgattatgactcaaaatatacacctggtggttctcttcatatt
tgtcctgcacaactttcattaaatatttaccaaaaagtgcaaagaatgtctttggcagca
catcaagctataggttgtcgaggtgttagccgttcagattttcgttttgttgaggagaca
gaggagctggtttggctagaaattaatacgcagcctggtatgacaccggtttctcttgtt
cctgatatagcaaaagcgagtggccgtacttacggtgatattgttaaatggatagcggag
gacgcgtcgtgtatgcgttga

DBGET integrated database retrieval system