KEGG   Bartonella sp. WD16.2: BWD162_013860Help
Entry
BWD162_013860     CDS       T05203                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
barw  Bartonella sp. WD16.2
Pathway
barw00020  Citrate cycle (TCA cycle)
barw00190  Oxidative phosphorylation
barw00650  Butanoate metabolism
barw01100  Metabolic pathways
barw01110  Biosynthesis of secondary metabolites
barw01120  Microbial metabolism in diverse environments
barw01130  Biosynthesis of antibiotics
barw01200  Carbon metabolism
Module
barw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
barw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
barw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:barw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWD162_013860
   00650 Butanoate metabolism
    BWD162_013860
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BWD162_013860
Enzymes [BR:barw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BWD162_013860
    1.3.5.4  fumarate reductase (quinol)
     BWD162_013860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer2 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AQX20475
UniProt: A0A1S6WW21
LinkDB All DBs
Position
complement(1533794..1534573)
Genome map
AA seq 259 aa AA seqDB search
MVQIRLPKNSRVKAGKIWPKPEGATQLIEFHIYRWSPDDEDNPRLDTYYVDRSACGPMIL
DGLLFIKNHIDPTLALRRSCREGICGSCAMNIDGVNTLACTKGMDDVKHPIQVYPLPSMP
VVKDLIPDLKRFYAQHRAIEPWLQTVSPEPAKEWLQSYSDRQKIDGLYECILCACCQTSC
PSYWWNGDRYLGPAVLLQAYRWIADSRDEMSGERLDNLEDPFRLYRCHTIMNCTQTCPKG
LNPAKAIAEIKKLMVERRL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaattaggcttcctaaaaattctcgtgtgaaggccgggaagatttggcctaaa
cctgaaggtgcgacacagctgatagaatttcacatttatcgttggtcgcctgatgatgag
gataatcctcgtcttgatacctattatgtggatcgctcagcatgtggtccgatgattctt
gatggtcttttgtttattaagaatcatattgatccaactttggcgcttcgtcggtcgtgt
cgtgagggcatttgtggttcatgtgcgatgaatattgatggggtcaatacgctggcttgt
actaaagggatggatgatgtgaaacatcctatccaggtgtatcctcttccttctatgccg
gttgttaaagatttgattcctgatttgaaacgtttttatgcgcagcatcgtgctattgaa
ccttggttgcaaactgtttcacctgagcctgcaaaagagtggttacaaagctattctgat
cgtcaaaaaattgatggtctttatgaatgtattctttgtgcatgttgtcaaacatcatgt
ccaagttattggtggaatggtgaccgttatttagggcctgctgttttacttcaggcttat
cgttggattgctgattcgcgcgatgaaatgagcggtgagcgtcttgataatctggaggat
cctttccggctttatcgatgccatacaattatgaattgtacacaaacttgtccaaagggt
ttaaatccggctaaagcgattgctgagattaaaaaacttatggttgaacgccgtctttaa

DBGET integrated database retrieval system