KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg_099Help
Entry
BUsg_099          CDS       T00087                                 

Gene name
hisI
Definition
(GenBank) histidine biosynthesis bifunctional protein
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
bas00340  Histidine metabolism
bas01100  Metabolic pathways
bas01110  Biosynthesis of secondary metabolites
bas01230  Biosynthesis of amino acids
Module
bas_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BUsg_099 (hisI)
Enzymes [BR:bas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BUsg_099 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BUsg_099 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH PI_PP_C
Motif
Other DBs
NCBI-ProteinID: AAM67669
UniProt: Q9ZHE0
LinkDB All DBs
Position
111044..111667
Genome map
AA seq 207 aa AA seqDB search
MLSKKENLLKLDWIKTNGLIPAIIQDFASNLVLMHGYMNKEAFLKTQKEGFVTFYSRTKK
RLWTKGEESGNLLKVIDIVTDCDYDTILIIVEPLGKTCHLNRKSCFFLKENTLNFLSKLE
DLIEDRKNFNTDNSYTARLYKSGTKRIAQKVGEEAIETILAAMKNDGDELINESSDLIYH
LIVLLHDQNLNFNLIIENLKKRKTEKL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaaaaagaaaatttattgaagcttgattggataaaaacaaatggtctaatt
ccagcaataatacaagattttgcatctaatttagttttaatgcatggatatatgaataaa
gaagcttttttaaaaactcaaaaagaaggttttgttactttttattctcgtactaaaaag
cgtttatggactaaaggagaagaatcaggtaacttactaaaagttatagatattgttaca
gattgtgattatgatactatattaattatagttgaacctcttggaaaaacatgtcattta
aatagaaaaagttgcttttttttaaaagaaaatacattaaattttctttctaaattagaa
gatcttatagaagatagaaaaaattttaatacagataattcatatactgctagattatat
aaatctggtacgaaacgtattgcacaaaaagttggtgaagaagctatagaaacaatatta
gcagcaatgaaaaacgatggagatgagcttataaatgaatcttcagatttaatttatcac
ttaattgttttattgcatgatcaaaatttaaattttaatttaattattgaaaacttaaaa
aaaagaaaaacagaaaaattataa

DBGET integrated database retrieval system