KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg_255Help
Entry
BUsg_255          CDS       T00087                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
bas00061  Fatty acid biosynthesis
bas00780  Biotin metabolism
bas01100  Metabolic pathways
bas01130  Biosynthesis of antibiotics
bas01212  Fatty acid metabolism
Module
bas_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BUsg_255 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BUsg_255 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BUsg_255 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bas01004]
    BUsg_255 (fabI)
Enzymes [BR:bas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BUsg_255 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BUsg_255 (fabI)
Lipid biosynthesis proteins [BR:bas01004]
 Fatty acid synthase
  Component type
   BUsg_255 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AAM67813
UniProt: Q8K9Q6
LinkDB All DBs
Position
291293..292075
Genome map
AA seq 260 aa AA seqDB search
MGILKGKKILITGILNEKSIAFGIAKSMYKQEAELIFVCQNKKIINKIKYLIKSINYNTI
FFCDVSHDENIKELFFNIKKVWNNFDGLVHSIAYCPKKQMHEDFVESSSRKSFNICHEIS
SYSFLSMARECKNMLNKFSSLVTLSYLGSQKIVSNYNMMGLAKSSLEANVRYMANSLGKN
NIRVNAISSGPIKTTSSYQIKNFNKIQKIHKLFSLTKNHVSSEEIGNVAAFLCSDLSIGI
TGSIINVDHGFNLNGINSII
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggaattttaaaaggtaaaaaaattttaattactggtatcttaaatgaaaaatcaatt
gcatttggtattgcaaaatcaatgtataaacaagaagcagaattaatttttgtgtgtcaa
aacaaaaaaataattaataaaataaaatatttaattaaatcaattaattacaatactatt
ttcttttgtgatgtatctcacgatgaaaatattaaagaactattttttaatataaaaaaa
gtttggaataattttgatggattagttcattctattgcttattgtcctaaaaagcaaatg
catgaagatttcgttgaaagcagcagtagaaaatcattcaatatatgtcatgaaattagt
tcatatagttttttaagtatggcgagagaatgtaaaaatatgctgaataaattttcctct
ctagtaacattatcttatctaggttcacaaaaaatagtatctaattataatatgatgggt
ttagcaaaatcttctttagaagctaatgttcgttacatggctaattcacttggtaaaaat
aatattagagtgaatgctatttcttctggacctattaaaactacatcttcttatcaaatt
aaaaactttaacaaaatacaaaaaatacataagttattttcattaacaaaaaatcatgta
tccagtgaagaaataggaaatgttgcagcctttttatgttcggatttatctattggaatt
actggttcaattattaatgttgatcacggttttaatttaaatggaataaattctataatt
taa

DBGET integrated database retrieval system