KEGG   Bifidobacterium asteroides: BAST_0060Help
Entry
BAST_0060         CDS       T02271                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00620  Pyruvate metabolism
bast00680  Methane metabolism
bast01100  Metabolic pathways
bast01120  Microbial metabolism in diverse environments
bast01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bast00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAST_0060
  09102 Energy metabolism
   00680 Methane metabolism
    BAST_0060
Enzymes [BR:bast01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BAST_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFU70665
UniProt: K4IYW3
LinkDB All DBs
Position
complement(88272..91031)
Genome map
AA seq 919 aa AA seqDB search
MTDSNQQITAADATLVTSGTGTKGPEERKLPQSLDEDMALCLRLLRDVLGEFDQQLLKRF
DSLREDVMTASAEHFNRHPSDPVPDEDGLSKAVALIDDTSVKDSQLLARALTTYFHLANL
CEENYRVKVLHEREGKVDLKVKGTDPINEMTSAYSQLLQEMGPAKASELLEKLEFHPVFT
AHPTEARRKAVEGKIRRIANLLAVRRGLGGSELEENERLLHNEIDALFRTSPIAAKKPTP
VEEANTILDIFDATLFETIPKVYRRFDDWMLGKKAGMVKPVCPAFFHPGSWIGSDRDGNP
NVTAKVSRKVARKFSDHMLEALVKATTTVGRNMTMEVTTTPPSSELRSLWSHQKEMSERL
TDRATTISHNELHRAVVLVIADRLQATIQRDADLMYADCDDFIADLRVVQDSLAKAGAVR
QAYGPLQDLIWQAQTFGFHMVEMEFRQHSLVHARALEDIREHGLHGERGELQPMTHEVLD
TFRALGAIQKRNGQKAARRYIISFTKSAQNVKDVYELNRLAFEHAEDVPVIDVIPLFEQL
EDLQNSVDVLEEIIKIPEVQARLKETGNKMEVMLGYSDSSKDAGPVSATLALHSAQERIA
KWAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVNCRFKLTEQGEVIFARYGNPV
LAIRHIESVAAATLLQSAPSVEERNTTMTEKYADMADELDQAAHERFLDLLHTPDFAPWF
SIVTPLNEIGLLPIGSRPAKRGLGAKSLDDLRTIPWVFSWAQARINLAAWYGLGTACEKF
GDLETLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLSLGDRDDLSQKVLSEMELTRK
WVLQIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVRALRTLRRRNDKEELSKSQQADF
IYLILCTVSGVAAGLQNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagtaatcagcaaatcacggctgccgatgcgaccctggtcacatccggcacc
gggaccaaggggccggaggaacgcaagctgcctcaatcgttggatgaggacatggccttg
tgcctgcggctgctcagggatgtgttgggggaattcgatcaacagctgctcaagcggttc
gactccctgcgcgaggacgtgatgacggccagcgccgagcacttcaaccgccacccctcg
gaccccgtgcctgacgaggacggcctgtccaaggctgtggccctgatcgacgacacctcg
gtcaaggattcccagttgctggcccgcgccctgaccacctacttccatctggccaacctc
tgcgaggagaactaccgggtgaaggtcctgcatgagcgcgagggcaaggtggacctgaaa
gtcaagggcaccgaccccatcaacgagatgaccagcgcctacagccagctccttcaggag
atgggcccggccaaggcctcggagctgctggagaagctggagttccaccccgtcttcacc
gcccaccccaccgaggcgcggcgcaaggccgtggagggcaagatccggcgcatcgccaac
ctgctggccgtccgccgcggcctgggcggctccgagctggaggagaacgagcgtctgctg
cacaacgagatcgacgccctcttccgcacctcgcccatcgcagccaagaagccgacgccc
gtcgaagaggccaacaccattctggacatcttcgacgccacgctcttcgagaccattccc
aaggtctaccgccgcttcgacgactggatgctgggcaagaaggccggcatggtcaagccc
gtctgccccgccttcttccacccgggcagctggatcggttccgaccgcgacggcaacccc
aacgtgactgccaaggtctcgcgcaaggtggcccgcaagttctccgaccacatgctcgag
gcactggtcaaggccaccaccaccgtgggccgcaatatgaccatggaagtgaccaccacc
cctcccagctccgagctgaggagcctgtggagccatcagaaggagatgagcgagcgcctg
accgatagggccaccaccatctcgcacaacgagctgcaccgggccgtggtcctggtcatc
gccgaccgtctgcaggccaccatccaacgtgacgccgacctcatgtatgccgactgtgac
gacttcatcgccgacctgcgcgtggtccaggactccctggccaaggcgggcgcggtccgt
caggcctacggccctctacaggatctgatctggcaggcccagaccttcggcttccacatg
gtggagatggagttccgccagcactccctggtccacgcccgcgccctggaagacatccgc
gagcatggcctgcacggcgagcgcggcgaactacagcccatgacccacgaggtgctcgac
accttccgggccctgggagccatccagaagcgcaacggccagaaggccgcccgccgctac
atcatctccttcaccaagtcggcacagaacgtcaaggacgtctacgagctcaaccggctg
gccttcgagcatgccgaggacgtgccggtcatcgacgtgatccccctgttcgaacagctg
gaggacctgcagaattcggtggacgtgcttgaggagatcatcaagatccccgaggtccag
gcccggctcaaggagaccggcaacaagatggaggtcatgctgggctactccgactcctcc
aaggatgccggcccagtctcggcgaccctggccctgcactccgcccaggagcgcatcgcc
aagtgggccgagagccatgacatcgacctgaccctcttccacggacgcggcggcgccgta
ggccgtggcggcggccctgccaaccgtgccgtactggcccagcctgtgggctcggtcaac
tgccggttcaagctgaccgaacagggcgaggtcatcttcgcccgctacggcaacccggtt
ctggccatccgccacatcgagtccgtggctgcggccaccctgctccagtccgcgcccagc
gtggaggagcgcaacaccaccatgaccgagaagtacgcggacatggccgacgagctggac
caggccgcccacgagcgcttcctggacctgctgcacacgccggacttcgccccctggttc
tccatcgtgacgcccctgaacgaaatcggcctgctgcccatcggctcccggccggccaag
cgcggtctgggcgccaagtccctggacgatctgcggaccataccctgggtcttctcctgg
gcgcaggcccgcatcaacctggccgcctggtacggcctgggcaccgcctgcgagaagttc
ggcgacctggagaccctgcgtcaggcctacgaggagtggccgctcttcagcaccttcatc
gacaacatcgagatgagcctggccaagaccgacgagcgcatcgccaagatgtacctctcc
ctgggcgaccgggacgacctgagccagaaggtcctctcggagatggagctgacccgcaag
tgggttctgcagatcgtgggcgacgagtggcccctgcagcaccgccacgtgctgggccag
gccatccggatccgctctccatatgtggatgccctgtcggtgacccaggtgcgcgccctg
cgcaccctgcgccgtcgcaacgacaaggaggaactcagcaagagtcaacaggccgacttc
atctacctgatcctctgcaccgtttcgggagtcgccgccggcctgcagaacaccggctga

DBGET integrated database retrieval system