KEGG   Bifidobacterium asteroides: BAST_0292Help
Entry
BAST_0292         CDS       T02271                                 

Definition
(GenBank) cydC, cytochrome D ABC transporter ATP-binding and permease components
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
bast  Bifidobacterium asteroides
Pathway
bast02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bast00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BAST_0292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bast02000]
    BAST_0292
Transporters [BR:bast02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BAST_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N AAA_16 TrwB_AAD_bind RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFU70889
UniProt: K4IKI3
LinkDB All DBs
Position
394372..396231
Genome map
AA seq 619 aa AA seqDB search
MGSPKASRRGRGLSGYMHIWHRDHWFWPYLRQNKGLLALIFFLGTITFVCAAGLMFTSGF
LISRSARHPFNIFAVYVPVVLTRAFGIGRPTFKYLERIKSHDWVLRVVSKLRVQLYRTLS
KDAAFLNEHERTGTVLGMLSDDLDHLENFYLRTIFPTVVAYMMWVVVTIAVGVFSWLTSL
LLFLLFALILILIPLVSLAYSDGRYDMEKARRQDQYTAVTESYMGLGDWVITRRRRRFVD
TASGDFNDIATGRREQKRFERWRNCGIQMIFALMVVALIVGGDLRMTSSTSIADFAAAVV
LAVFPLVDCFIVVSQAVAEVPLYTDSLDHLNDLTERVESRQIAPSPQTKLEGPIKSIVFD
HVSFSYGPDDPLLLDDFSLRIEGGQRVALLGPSGEGKTTVLQLLLGDLRPTSGRILINDI
PVDALQDQRPELFGYLNQQAFLFNTTIASNVRLGAPQADDDQVRQALKAVQLDQVVADMP
QGIDTPVDEAGGRLSGGQRQRLALARIVLKRTPIILLDEPTIGLDPITERRLMAMIFKVS
QDRTLLWVTHHLQGLEEADQVIFMQDGHIAMQGRPVDLYRENARFRELYRMDVSDVDKGA
GQGIYLKKQSDSDGRNPVE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgcctaaggcctcccgccgcggccgcggactgtcgggctacatgcatatctgg
caccgggaccattggttctggccctacctgcgtcagaacaaggggctgcttgccctgatc
ttcttcctgggaaccatcaccttcgtatgcgcagccgggctgatgttcacctcaggcttc
ctgatcagcaggtctgcccgtcatcccttcaacatctttgccgtgtacgtgccggtggtc
ctgaccagggccttcggcattggacggcctacattcaagtacctggagcgcatcaagagc
catgactgggtgctccgagtggtttccaagctacgggttcagctttaccgcaccctttcg
aaggacgcagctttcctgaacgagcatgagcgtacaggcacggtacttggcatgctctcg
gacgatctggaccacttggagaacttctatctgcgcaccatcttccctacggtagtggcc
tacatgatgtgggtggtggtcaccatagctgtaggcgtcttctcctggctgacctcgctc
ctactcttcctgcttttcgctctgatcctgatcctgatcccgctggtctcgctggcttat
tcagacgggcgttatgacatggagaaagcgcggcggcaggaccagtacactgcagtgacc
gagagctacatgggcctgggggactgggtgatcactcgccgtcgtcggcgttttgtggat
acggcgtccggcgacttcaacgatatcgccaccggccgcagagagcagaagcgatttgaa
cgctggcgcaactgtggtatccagatgattttcgcccttatggtggtggccctgattgtg
gggggagatctgcgtatgaccagctccacttccatagctgacttcgcggcagccgtggtc
ctggcggttttccccttggtcgactgcttcatcgtggtctcgcaggcagtggctgaggtt
cccctctacacagattcgctggaccacctgaatgatctgaccgagcgggtcgagtcccgg
caaattgcgccaagtccccagaccaagctggaggggccgatcaagtcaatcgtcttcgat
catgtcagcttctcctacggacctgatgaccccctgttgctggacgacttcagcctgcgg
attgaaggtgggcagcgggtggctctgctcggtcccagcggagagggcaagacaacggtt
cttcagctgcttttaggcgatctgcgccccaccagtggccgcatcctcatcaacgacata
ccagtcgacgcactgcaggatcagcgtcctgagctcttcggctacctgaaccagcaggca
ttcctcttcaacaccactatcgcctctaacgtgcgtctgggggccccacaggctgatgat
gaccaggttcgtcaagccttgaaggctgtacagctggatcaggttgttgctgacatgccg
cagggaatcgacacgccggttgatgaagctggcggtcgtctttcaggcgggcagcgccag
cgtctggccctggccaggatagtgctcaagcgtactccaatcatccttttggacgagccc
accatcggtttggatcccataaccgagcgcaggctcatggccatgatcttcaaggtcagc
caggatcgtacccttctttgggtgacccaccacctgcaggggctggaggaggccgaccag
gtcatctttatgcaggacgggcacatcgccatgcagggtcggcctgtcgacctgtaccgg
gagaacgcccgtttccgtgaactttatcgcatggacgtctcggacgtggacaagggtgcc
ggtcaagggatatacttaaagaagcagtcagattcagatggacggaaccctgttgaatga

DBGET integrated database retrieval system