KEGG   Bifidobacterium asteroides: BAST_0717Help
Entry
BAST_0717         CDS       T02271                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00020  Citrate cycle (TCA cycle)
bast00480  Glutathione metabolism
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
bast01120  Microbial metabolism in diverse environments
bast01130  Biosynthesis of antibiotics
bast01200  Carbon metabolism
bast01210  2-Oxocarboxylic acid metabolism
bast01230  Biosynthesis of amino acids
Module
bast_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bast00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAST_0717
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAST_0717
Enzymes [BR:bast01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAST_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AFU71304
UniProt: K4ILN0
LinkDB All DBs
Position
complement(969534..970769)
Genome map
AA seq 411 aa AA seqDB search
MEKVTVKGRIVELDGDEMTRVIWKMIKERLILPYLDVDLDYYDLGIRNRDATDDKVTVQA
AQAIQREHVGVKCATITPDEARVKEFGLKRMWKSPNGTIRNILGGTIFREPIVIDNIPRL
VPGWSKPIVVARHAFGDQYQATDFTVPKPGKLSVVFTPEDGSDPVTREVTTYPGPGVAQV
QFNLDDSIRDFARSCFNYALQRHYPVYLSTKNTILKAYDGRFKDIFAQVYAQEYQGRFEE
EGLTYQHRLIDDMVASSLKWQGGYVWACKNYDGDVQSDAIAQGFGSLGLMTSMLMTADGQ
TVEAEAAHGTVTRHYRRWLKGETTSTNPIASIFAWTGGLKQRARLDGTPKVARFAQTLES
VVIETVRSGRMTKDLASLVGPDQPWLDTEGFMDALDQALAERMASAAAKAD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtcaccgtgaagggacgcatcgtcgagctcgacggtgacgagatgacccgg
gtcatctggaaaatgatcaaggaacggctgattctgccctatctggacgtggacctggac
tattacgacctgggcatccgcaacagggacgccaccgacgacaaggtcaccgtacaggcg
gcccaagccatacagcgcgagcatgtgggtgtcaagtgcgccactattacccctgacgag
gcccgggtgaaggaattcggtcttaagcgcatgtggaagtcacccaacggaaccatccgc
aacattcttggaggaaccatcttccgcgagcccatcgtcatcgataacatcccccgactg
gttccaggatggtccaagcccattgtggtggcccgccacgccttcggtgaccaataccag
gccactgatttcaccgttcccaagcctggaaagctgagtgtcgtctttactcctgaggac
gggagcgacccggtgacccgagaggtgaccacctacccaggaccaggcgtggcccaggtt
cagttcaacctcgacgactccatccgcgacttcgcccgctcatgcttcaactatgccctg
cagaggcactatccggtctacctaagcaccaagaacaccatcctcaaggcctacgacgga
cgcttcaaggatattttcgcccaggtctacgcgcaggagtaccagggtcggttcgaggaa
gaggggctgacctaccagcatcgtctgattgacgatatggtggcctcctcgctcaagtgg
cagggcggctatgtctgggcctgcaagaactacgatggcgatgtccagtccgatgcaata
gctcaagggttcggttcccttggcctcatgacctccatgctgatgacggcagacgggcag
acggtagaggccgaggccgcccatgggaccgtgaccaggcattaccggcgctggctcaag
ggcgagaccacctccaccaacccgatcgcctctattttcgcctggaccggcggactcaag
cagcgggcacggctggatggcacgcccaaggtagcccggttcgcacaaactttggagtct
gtggtcatcgagaccgtgcgctccggccgtatgaccaaggacctggccagcctggttggt
cccgatcagccctggctggacaccgaagggttcatggatgccctggaccaagcccttgcc
gagcgtatggcttcagctgctgccaaggcagactag

DBGET integrated database retrieval system