KEGG   Bifidobacterium asteroides: BAST_1306Help
Entry
BAST_1306         CDS       T02271                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00030  Pentose phosphate pathway
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
bast01120  Microbial metabolism in diverse environments
bast01130  Biosynthesis of antibiotics
bast01200  Carbon metabolism
bast01230  Biosynthesis of amino acids
Module
bast_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bast_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bast00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAST_1306
Enzymes [BR:bast01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BAST_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind NETI
Motif
Other DBs
NCBI-ProteinID: AFU71875
UniProt: K4J2A2
LinkDB All DBs
Position
1671215..1671913
Genome map
AA seq 232 aa AA seqDB search
MDKTEQDRLKKAAGIEAAKLVENGMTAGLGTGSTVRFFVDELGRRVKEEGLEFTGVTTSR
RTKEQAEGYGIHIVDIDQVDHIDVTIDGADEVDKDFNGIKGGGAALLWEKIVAVNSRKIV
WIVDESKVVDTIGRFPLPVEVIPFGERHVLDRFKERGYNPVLRLDGQGQPVLTDEHNHII
DLHLDRIEHPQDLAQDLITTVGVVEHGLFLNMVDTVIVGDPNGPRVMTNANK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaccgagcaggacagactgaagaaggccgccggcatcgaagcagccaagctg
gtcgagaacggcatgaccgctggactgggcaccggatccacggtccggttcttcgtggat
gaactgggacggcgcgtcaaggaggagggcctggagttcaccggcgtgaccacctcccgg
cggaccaaggagcaggctgaaggctacggaatccacatcgtcgacatcgaccaggtggat
cacattgatgtcaccatcgacggggccgacgaggtcgacaaggacttcaacggcatcaag
ggcggcggcgcagccctgctctgggagaagatcgtggccgtcaattctcgaaagatcgtc
tggattgtggacgagtcaaaggtggtcgacaccatcggccgcttccccctgccagtggag
gtcatccccttcggcgagcgccacgtcctggatcgcttcaaggagcgcggctacaaccca
gtactgcggctggacggccaggggcagccggttctgaccgacgagcacaaccacatcatc
gatctgcatctggatcggatcgagcacccgcaggatctggcccaggacctgatcaccacc
gtgggtgtcgtggagcacggcctcttcctcaacatggtcgacacagtcatcgtgggcgac
cccaacggaccccgggtcatgaccaacgccaacaagtga

DBGET integrated database retrieval system