KEGG   Bacillus anthracis Sterne: BAS0812Help
Entry
BAS0812           CDS       T00184                                 

Definition
(RefSeq) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bat  Bacillus anthracis Sterne
Pathway
bat02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bat00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BAS0812
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bat02000]
    BAS0812
   02035 Bacterial motility proteins [BR:bat02035]
    BAS0812
Transporters [BR:bat02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    BAS0812
Bacterial motility proteins [BR:bat02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BAS0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd TraB ADH_zinc_N CBM77
Motif
Other DBs
NCBI-GeneID: 2850154
NCBI-ProteinID: YP_027088
LinkDB All DBs
Position
863709..864506
Genome map
AA seq 265 aa AA seqDB search
MKKLFSVLAVTTLAIGIVAGCGKEEKKDTASQDALQKIKQSGELVIGTEGTYPPFTFHDS
SNKLTGFDVELAEEVAKRLGVKPVFKETQWDSLLAGLDAKRFDMVANEVGIREDRQKKYD
FSKPYVSSSAALVIAKDKDKPATFADVKGLKGAQSLTSNYADIAKKNGAEIIGVEGFSQA
AELLASGRVDFTINDKLSVLNYLETKKDAKIKIVDTEKEASESGFLFRKGSTKLVQEVDK
ALEDMKKDGTYDKITKKWFGENVSK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattattttcagtgcttgcagtaactacattagcgatcgggattgtagccggc
tgcggtaaagaagagaaaaaagatacagctagtcaagacgcattacaaaagattaaacaa
agcggagaacttgtaattggtacagaaggtacatacccaccatttacgttccacgattca
agcaataaattaactggatttgacgttgaattagcagaagaagttgcaaaacgtttagga
gtaaaacctgtatttaaagaaacacaatgggatagcttacttgctggtttagatgcgaaa
cgctttgatatggttgcaaacgaagttggtattcgtgaagaccgtcaaaagaaatatgat
ttctctaaaccatacgtttcatcttcagcggcattagttatcgcaaaagataaagataaa
cctgctacatttgctgatgtaaaaggattaaaaggagcacaatctttaacaagtaactat
gcagatatcgctaagaaaaacggtgcagaaattattggtgtagaaggatttagccaagca
gcagaactattagcttcaggacgcgttgatttcacaatcaatgataaattatcagtgtta
aattatttagaaacgaaaaaagatgcgaaaattaaaattgtagatacagaaaaagaagct
tcagaaagtggattcttattccgtaaaggtagcactaagcttgtacaagaagtagataaa
gcgttagaagatatgaaaaaagacggtacgtatgacaaaataacgaaaaaatggtttggt
gaaaatgtatctaagtag

DBGET integrated database retrieval system