KEGG   Bacillus anthracis Sterne: BAS0961Help
Entry
BAS0961           CDS       T00184                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00564  Glycerophospholipid metabolism
bat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAS0961
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAS0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 FAD_oxidored GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 2852747
NCBI-ProteinID: YP_027235
LinkDB All DBs
Position
1017026..1018708
Genome map
AA seq 560 aa AA seqDB search
MKFSSKQRKDVLNGVNKQELDVIVIGGGITGSGIALDGATRGLSTIVFEMQDFAAGTSSR
STKLVHGGLRYLKQLEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHTGGTFGSFSTSI
GLRVYDFLAGVKRSERRKMFNREETLKKEPLVKQEGLKGGGYYVEYRTDDARLTIEVMKE
AIEHGAKAVNYAKVDGFLYKDGKVCGVRVIDLLDGEVYEVYGKKIVNAAGPWVDTLREKD
NSKKGKVLQLSKGVHLVIDQKRFPLGQAIYFDTPDKRMVFAIPRGGKTYVGTTDTFYDKD
AAVPQMTTEDRTYIINAINYMFPSVKITEKDIESSWAGVRPLIYEEGKSASEISRKDEIW
TSESGLITIAGGKLTGYRKMAEMVVDYVTNLLQKEGHSAYPKSSTKHMPISGGHVDGSKG
LPAFIAKKAGEGTKYGLTTAQAEEFAKFYGSNVDVLFDLAKKHKDEAKEYNMPLDVLIPL
VYAMDYEMTAKPVDFFVRRRGAVFFNIHWVYEWKEAVINYMAAKLGWSKEEQMKYTAELE
KALTDAVIPVDQQEHAAALA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaagtaaacaacgtaaagacgtattaaacggagtaaataaacaagaatta
gatgtgatcgtaattggtggaggtattactggttctggtattgcattagatggagcaaca
cgcgggttatcaacaattgtgtttgaaatgcaggactttgcagcaggtacatcaagtcgt
tcaacgaagcttgtgcacggtggtctacgttatttaaaacaacttgaagtgaaaatggta
gcagaggtgggtaaagagcgtgcgatcgtatatgagaacggtccccatgtaacaacacca
gagtggatgttacttccgttccatacaggaggtacgttcggatcatttagtacatcaatt
ggtcttcgtgtatacgacttcttagcaggtgtaaaacgaagtgagcgcagaaaaatgttt
aaccgtgaagaaacgctgaagaaagagcctcttgtaaaacaagaaggattaaaaggtggc
ggttactacgtagaatatcgtacagacgatgcacgtcttacaattgaagtaatgaaagaa
gcaattgagcacggcgcaaaagctgttaattacgcaaaagtagacggtttcttatataaa
gatggaaaagtatgtggtgtacgtgtaatcgatttactagacggagaagtatacgaagtt
tacggtaagaaaattgtaaacgcagctggtccttgggtagatacacttcgtgaaaaagat
aactcgaaaaaaggaaaagtacttcagttatcaaaaggtgttcacttagtaattgatcaa
aaacgtttcccattaggtcaagcgatttacttcgatacaccagataaacgtatggtattc
gcgattccacgcggcggaaaaacatacgtaggtacaacagatacgttctatgataaagac
gcagctgtaccacaaatgacaacagaagatcgcacgtacatcattaatgcgattaactac
atgttcccaagcgtaaaaattacggaaaaagacatcgaatcaagctgggctggtgtacgt
ccgttaatttacgaagaaggtaagagtgcatctgaaatttctcgtaaagacgaaatttgg
acttctgaatctggtttaattacaatcgcaggtggtaaattaacaggataccgcaaaatg
gctgaaatggtagtagactacgtaacgaacttactacaaaaagaaggtcacagtgcatat
ccgaagagctcaacgaaacatatgccaatctctggtggacatgtagatggctctaaaggg
ttaccagcatttatcgcgaaaaaagcaggcgaaggtacgaaatacggtttaacaacagca
caagcagaagaattcgcgaaattctatggctctaacgttgacgtactattcgacttagca
aaaaaacataaagacgaagcgaaagaatacaacatgccactagacgttctaatcccactt
gtatacgcaatggattacgaaatgacagcaaaaccagtcgacttcttcgtacgccgcaga
ggcgctgtattcttcaacatccactgggtatacgagtggaaagaagcagtaatcaactac
atggctgcgaaactaggctggagcaaagaagaacaaatgaaatacacagctgaattagag
aaagcattaacagacgctgtcattcctgtagatcaacaagaacatgcagctgcgttagcg
taa

DBGET integrated database retrieval system