KEGG   Bacillus anthracis Sterne: BAS4412Help
Entry
BAS4412           CDS       T00184                                 

Gene name
sdhB
Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00020  Citrate cycle (TCA cycle)
bat00190  Oxidative phosphorylation
bat00650  Butanoate metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
Module
bat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAS4412 (sdhB)
   00650 Butanoate metabolism
    BAS4412 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAS4412 (sdhB)
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAS4412 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BAS4412 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-GeneID: 2851658
NCBI-ProteinID: YP_030659
LinkDB All DBs
Position
complement(4320867..4321628)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagacggaccagacgcgcaagcg
tttgatcaagagtttgaaattccttatcgtccgaatatgaatattatttcggcgcttatg
gaaattcgccgtaatcctgttgattcaaaaggaaaccaaacgactccgattgcgtgggat
atgaactgtttagaggaagtgtgtggtgcatgttcgatggtgattaacggaaaaccacgt
caatcatgtacagcacttatcgatcaattagagcaaccaattcgcttaaaaccgatgaag
acattcccggttgttcgtgacttacaagttgaccgtagtcgcatgtttaatgctctaaaa
cgtgttaaagcttggattccaattgatggtacgtatgacttaggaccagggccaagaatg
ccagagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaatagtaaatctgactttattggaccagcaccgttatca
caagctcgtttattcaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcaattatgggtgatggaggacttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccaaagggtattccattaacaacttcaattgcggcgttaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgacaataactattaa

DBGET integrated database retrieval system