KEGG   Bacillus anthracis Sterne: BAS4413Help
Entry
BAS4413           CDS       T00184                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00020  Citrate cycle (TCA cycle)
bat00190  Oxidative phosphorylation
bat00650  Butanoate metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
Module
bat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAS4413 (sdhA)
   00650 Butanoate metabolism
    BAS4413 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAS4413 (sdhA)
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAS4413 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BAS4413 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 2851654
NCBI-ProteinID: YP_030660
LinkDB All DBs
Position
complement(4321621..4323414)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVVDDEGVCRGIVAQDLQT
MEIKSFGADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTNIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
STVYEQNELIETEKFNNILTLDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEDVDISLIKPRKRDYSSKHDVAAKGEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcggaagcaggagtaaatgttgaactgttctctttagtaccagtaaaacgttcgcat
tctgtatgtgcccaaggtggaattaacggtgccgtgaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggacttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtatcattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgttttggtggaacgcaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactatacgcattagatgag
caagtacgtcgtcatgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttgttgatgacgaaggtgtgtgccgaggaatcgttgcacaagacttacaaaca
atggagattaaaagtttcggagctgatgccgtgattatggcaacagggggccctggtatc
atcttcggaaaatcaactaactctattattaatacaggtacagcagcttctgctgtatat
caacaaggcgcatattatgcaaacggtgagttcattcaaattcacccaacggcaattcct
ggagacgataaattacgtcttatgagtgaatctgcacgtggtgaaggtggacgtgtttgg
acatataaagatggtaaaccatggtacttcttagaagaaaaatatccggcttacggaaat
cttgtacctcgtgatatcgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaatatggtttacttagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaaatttacaggtgatgatcctcgt
aaactaccaatgaaaatcttcccagctgttcactattcaatgggcggactatgggttgat
tataaacagatgacaaatattccaggtttatttgcagcaggtgagtgtgattattctatg
cacggtggtaaccgtcttggtgcgaactcactattatcagcaatttacggtggtatggta
gcaggaccgaatgcaattgaatatatgaaaggtctttctaaatcatcagatgctgtttca
tctactgtgtatgaacaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
ctcgatggtaacgaaaatgcgtatgttcttcataaagagcttggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaaattattagaaacagatgcaaaaattgaagag
ttaatggctcgttataaacgtattaacattaacgatacagcaagatggagtaaccaaggt
gcttcatttacacgccaacttgcaaatatgtttgagctagcacgtgttattacaattggt
gcatataaccgtaatgagagccgtggggcgcattacaaacctgaattcccaaatcgtgat
gatgcaaacttcttaaaaactacgatggcaaaatttgaaggagaaggaaatgcaccagca
ttccattatgaagatgtggatatttcattaattaaaccacgtaaacgtgattattcttca
aaacacgatgtagctgctaagggtgaagagaagggggataaacaacatgtctga

DBGET integrated database retrieval system