KEGG   Bacillus anthracis Sterne: BAS4487Help
Entry
BAS4487           CDS       T00184                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00020  Citrate cycle (TCA cycle)
bat00480  Glutathione metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
bat01210  2-Oxocarboxylic acid metabolism
bat01230  Biosynthesis of amino acids
Module
bat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bat_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAS4487
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAS4487
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAS4487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 2851556
NCBI-ProteinID: YP_030735
LinkDB All DBs
Position
complement(4400714..4402021)
Genome map
AA seq 435 aa AA seqDB search
MGVITLTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKK
IVWKEVLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDL
YVCLRPVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMG
VNKIRFPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNW
GYEVAEQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILT
RPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLD
KVNPSSVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFA
NELIKNMDVAIIKNA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggggttatcacattgacgacaggtgaaaaaattactgtaactaatggtgttatgaat
gtaccaaacaatccgattattccatttatcgaaggagatggaattggtcctgatatttgg
gcagctgcatctcgtgtactagaagcagcagttgaaaaagcttatgatggtgagaagaaa
atcgtttggaaagaagtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggtta
ccagaagaaactttaaatttaattcgtgaatatttaatcgcgattaaaggtccacttaca
actccagttggcggtggtattcgttctctaaacgtagcacttcgtcaagaattagattta
tatgtatgtctacgtccagttcgttattttgaaggtgttccttcacctgtaaaacgtccg
gaagatactgatatggttattttccgtgaaaatacagaagacatttatgctggaattgaa
tatgcgcaaggatctccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggt
gttaataaaatccgcttcccagaaacatctggtattggtattaaaccaatctcagaagaa
gggacaaagcgtcttgttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttct
gttacattagttcataaaggaaacattatgaaattcacagaaggtgctttcaaaaactgg
ggttacgaagtagcggaacaagaattcggcgacaaagtatttacttgggctgaatatgat
cgtatcgttgagaaagatggtaaagatgcagcgaataaagcgatggcagacgctgaagtg
gctggaaaaatcatcgtaaaagattctattgcagacatcttcttacaacaaattttaact
cgtccacgtgagttcgatgttgttgcaacaatgaacttaaacggagactacatctctgat
gcacttgctgcacaagtaggtggaattggtattgcacctggtgcaaacattaactatgtg
actggacatgctatctttgaagctacgcacggtacagctccaaaatatgcaggtttagat
aaagtaaacccatcttcagttcttctttctggtgtattattattagagcacttaggatgg
aacgaagctgcgaaattagtaactgcttcagttgagaaaacaattgcttcaaaagtagta
acttatgatttcgcacgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgct
aatgaacttattaaaaacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system