KEGG   Bacillus anthracis Sterne: BAS4878Help
Entry
BAS4878           CDS       T00184                                 

Definition
(RefSeq) transpeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
bat  Bacillus anthracis Sterne
Brite
KEGG Orthology (KO) [BR:bat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAS4878
Enzymes [BR:bat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BAS4878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-GeneID: 2847842
NCBI-ProteinID: YP_031120
LinkDB All DBs
Position
4759384..4760223
Genome map
AA seq 279 aa AA seqDB search
MKRTIVMIVMIATLFTGMIFFSYAQRQQAVRADQPSITGQYGITIDADTGEILYGKREDE
RSYPASIAKMMTTLLLLENVKEDEEITVTENAIKTESQSKKIKLRAGEKLKRDEALKLML
IISADPIAESIAEHIAGSKNEFVKMMNARAKELGTKHATFKNASGADALGNKVSPYDIAM
ITKEALKYPVVLEYMNSTRTTLHTSERSPNIANYGREELYDDPYAIGSKSGLSALGKYTV
VTVDEKDGKRVINVVLSSTRKQLYPDTKKMAHYAFQQLK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaacaatagttatgattgtaatgattgccacactatttacagggatgattttc
ttctcttatgcacaaagacaacaagctgtaagagccgatcagcccagcatcactggacaa
tacggaattacaatcgatgcagacacaggtgaaattttgtatggaaaacgagaagacgaa
cgctcttatccggctagtatagccaaaatgatgacaacccttcttttactagaaaatgta
aaagaggatgaagaaattacagttacagaaaacgcaattaaaacagaaagtcaaagtaag
aaaattaaacttcgtgctggggaaaagttaaaacgtgatgaggcattaaaactgatgctt
atcattagtgcagatccaatagctgaatccatcgcagaacatattgcaggatcaaaaaat
gaatttgtaaaaatgatgaatgctagagcgaaggaacttggtacaaaacatgcgactttc
aaaaatgcaagtggtgctgatgcattaggaaacaaagtatcaccatatgacattgctatg
attacgaaagaagcattaaaatacccagttgttttagaatatatgaattcaacgcgtaca
actctacatacttcagaacgctctccaaacatcgcaaactatggacgagaagaactatat
gacgatccatatgcaattggaagtaaaagcggtctatcagcactcggaaaatatacagtc
gtaacagtggatgagaaagacggtaaacgcgtcattaatgttgtattatcttctactcgc
aagcaactgtatcctgatacgaagaaaatggcacattacgcatttcagcaattaaaataa

DBGET integrated database retrieval system