KEGG   Bacillus atrophaeus NRS 1221A: TD68_00880Help
Entry
TD68_00880        CDS       T03711                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
batr  Bacillus atrophaeus NRS 1221A
Pathway
batr00627  Aminobenzoate degradation
batr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:batr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TD68_00880
Enzymes [BR:batr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     TD68_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: AJF84074
LinkDB All DBs
Position
192823..194280
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWREGAGSSLLEDKNPYTQKNITSFRKANTDDVDEAYKSAAHAKKK
WDAVNPFEKRTILEKAVAYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFP
VRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSVKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGIPEGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRILVHSSIH
DRFLEMYQAKVESLKVGDPMDPETIIGPLINSRQTDALMKSVEKAIEEGAVPVTLGGFAG
TVVEPTILKDVKPSMSIAHEELFGPVVSVMKFDSEDEAVDIANDTPFGLSGAVHTANVER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTMKWISVQHEK
RNFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaattaaacaaacagtttattgggggaaaatggcgtgagggcgcc
ggttcaagtcttttggaagataagaacccatatacccaaaaaaatatcacatcattccgt
aaagcaaatacggatgacgtagatgaagcatacaagtcagccgcacatgcaaagaaaaaa
tgggacgcggtgaatccgtttgaaaaaagaacgattcttgaaaaagccgtggcttatatt
gaagaaaatgaagaagccattatttatctgattatggaggagctcggcggaacaaggctg
aaagccgcgttcgaaatcggcctagtgaaaaatatcataaaagaagcagcgacatttccg
gtgcggatggaaggcaaaattctcccatccaccattgacggcaaagaaaacagattgtac
agagtgcctgccggtgtggtcggcgttatcagtccgtttaactttcctttcttcctatct
gtgaaatccgtcgcgcccgcgctgggagccggaaatggagtcgtgctgaagccgcatgaa
gaaactccgatttgcggcggtactttgatcgcgaagatttttgaagcggccggcattcct
gaagggcttttgaacgtagtcgtcactgatatcgcagaaatcggcgacagctttgtggag
catcctgtgccgcggattatctcgtttacgggttctacaaaagtgggcagctatatcggc
cagctggcgatgaaacatttcaaaaaacctttgcttgagcttggcggaaacagtgcgctt
atcgtgcttgaagatgctgatcttgaatatgcggtcaatgcggcggtgttcagccggttt
acgcatcaggggcaaatatgtatgtctgcaaaccgcatcttggttcattcttctatccat
gacagatttctggagatgtatcaggcgaaagtggagtcacttaaagtcggagacccgatg
gaccctgaaacgattatcggaccgttaatcaacagcagacaaaccgatgcgttaatgaaa
tctgttgaaaaagcgatagaagaaggagcggttccggttacactcggcggattcgcggga
acagtcgtggagccgacgattttaaaagacgtcaaaccttccatgagcattgcccatgaa
gaattgttcggaccggtggtttcagtgatgaagtttgattcggaagacgaagcggttgat
attgcgaatgatacgccgtttggtttaagcggagcggttcatacggccaatgttgaacgc
ggcgtcgcatttgcgaaacgaattgagaccggaatgatccacgtcaatgatacgacgatc
aacgatgagccgaacgtagccttcggcggagaaaaacaatcaggcctcggccgattaaac
ggcgaatggagccttgaagaatttacaacgatgaaatggatttccgttcagcatgaaaaa
cgcaatttcccatactaa

DBGET integrated database retrieval system