KEGG   Bacillus atrophaeus NRS 1221A: TD68_07555Help
Entry
TD68_07555        CDS       T03711                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
batr  Bacillus atrophaeus NRS 1221A
Pathway
batr00020  Citrate cycle (TCA cycle)
batr00310  Lysine degradation
batr00380  Tryptophan metabolism
batr01100  Metabolic pathways
batr01110  Biosynthesis of secondary metabolites
batr01120  Microbial metabolism in diverse environments
batr01130  Biosynthesis of antibiotics
batr01200  Carbon metabolism
Module
batr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
batr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:batr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TD68_07555
  Amino acid metabolism
   00310 Lysine degradation
    TD68_07555
   00380 Tryptophan metabolism
    TD68_07555
Enzymes [BR:batr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     TD68_07555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJF85290
LinkDB All DBs
Position
complement(1615972..1618806)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMNWEEFYGPNLGYALELYDQYVKDPNSIDPDLKDMFDELGAPPSQIKEASG
TKEPGRITADLIQKIASAVKLAEDIRTYGHLNASVNPLRKDREKRELFPLSDYGLTEQEI
KEIPASVICKDAPKNITNGIEAIEHLRNTYKKTISFEFDHVHHFEEREWLTNMVESGELF
QKNSPEKLAAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAKSVKAGTT
SVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKELVPSEGSVGISYGWTGDVKYHLG
AKRHLQDAETKSARITLANNPSHLEFIDPIVEGSTRAAQETRTQSGYPEQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLNGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKKFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKQIFAEKLIKEGQISEETVQNIEQSVAKRIEDAYQKVPAKKEDAVREIELPE
PVSNGFPDVDTSIHFDVLRKLNGELVNWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSDCEASFAVHN
SPLSEGSVIGFEYGYNVYSPETLVIWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRIERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESQFQPVYEQSGLSHAYEKVTRLVLSSGKVSIDISDHF
NKLEDGKDWLHIARVEELYPFPAKEIKELFAKLPNLEEIVWVQEEPQNMGAWSYISPYLS
EVAPEGVSVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaaagaatgaattgggaagaattttacggtccgaacctc
ggctacgcgctggagctttacgatcaatatgttaaagatccgaatagtatcgacccggat
cttaaggacatgtttgatgaactgggagctccgccgagccaaataaaagaggcatcggga
actaaagaaccgggacgcatcacagccgatctgatacaaaagatcgcatcagcagttaaa
cttgcagaagatatacgaacctatggccatttaaacgcttccgttaatccgctcagaaag
gatcgggagaagcgagagttgtttccgttatccgattacgggctgacagaacaggaaata
aaagaaataccggcgtccgtgatttgcaaagacgctcctaaaaacattacgaacggcata
gaagccatcgaacatttaagaaacacctataaaaaaacaatctcatttgaatttgaccat
gtgcatcatttcgaagagcgggaatggctcacgaatatggttgagtcaggcgaattgttt
caaaagaattcaccggaaaagctggcagccgttttagaaaggcttacggaagtggaaggc
tttgagcagtttttacaccgcaccttcgtcggccaaaagcgtttttcgatcgaaggactg
gatgctctcgtgccggtgcttgatgatattattgcgaagtccgtcaaagcgggcacaaca
agcgttaatatcggaatggcgcacaggggccgcctgaatgtgctggcacatgtgcttggc
aaaccgtatgaaatcattttctcggaattccagcatgcgccaaacaaagaactagttccg
tctgagggatctgtcggaatcagctacggatggacaggggacgtcaaataccatctgggc
gcgaaaaggcatcttcaagacgctgaaacaaagtctgcacggatcacgttggcgaacaat
ccgagccacttggaattcattgatccgatagtggaagggagcacgcgagccgctcaagaa
acgagaacacaaagcgggtatcctgagcaggatgaaacgaaatcacttgccattcttatc
catggtgacgcagcgttccctggagaaggaattgtcgcagaaacgttgaatttgagttcg
cttaacggctatcaagtcggcggagcgattcatatcattgccaataatatgatcggattt
acgacagaaagcgatgaatcaagatcaacgaagtatgccagtgacttggcaaaaggatat
gaaatcccgattgttcacgtgaacgcagacgatcctgaagcttgtctttcagcagtgaag
tttgcagttgaataccgcaaaaaattcaataaagatttcttgattgatctaatcgggtac
agacgttacggccacaacgaaatggatgagccatcaacgactcagccgatgttatacgac
gccgtcagaaagcaccctaccgtgaaacagatcttcgcagaaaagctgataaaagaaggg
cagatcagcgaagaaacggttcaaaacattgagcaatctgtggcgaaaagaatagaggac
gcctatcaaaaggttcctgcgaaaaaagaagatgctgtccgtgaaattgaacttccggaa
cctgtttcaaacggcttcccggatgttgacacatccattcattttgatgtgctgcgcaag
ctgaacggagagctggtcaattggccggaatcatttaacgtattcggcaaattgaaacgc
attcttgaaagacgggccaaagcatttgatgatgatcgcaaagttgaatggtcattggcg
gaatcactcgcatttgcgtcgattttaaaagacggaacaccgattcgcttgacggggcag
gattctgaacgcggaacgttcgcacaaagaaaccttgtgcttcatgacagtgagacaggc
aaagagtttgtgccgctgcatcatttatccgattgcgaagcatccttcgccgtacacaac
agtccgctttcagaagggtccgttatcggttttgaatatgggtataacgtgtattcacca
gaaactttagtgatttgggaagcccaatacggcgatttcgccaacgcggctcaagtgtat
tttgaccagttcatttctgcgggacgggcaaaatggggccagaaatccggcttagttatg
cttcttccgcatggttatgaaggacaagggcctgaacactcaagcggaagaattgagcgt
ttccttcagcttgcggctgaaaataactggacggttgccaacttgacaagcgctgcccaa
tacttccatattttaagaagacaggcaaaaatgcttctccgcgaggaaattcgtccgttg
gtgatcatgacgccaaaaagtcttcttcgtaatccgaatacagtgtcagaagtacaggaa
ctaagcgaaagccaattccagccagtctatgaacagtcaggactctctcatgcttatgaa
aaagtaacgcgtctcgttttatcgagcggtaaagtgtccattgacatcagtgatcatttt
aataagttggaagacgggaaagattggcttcacattgcgagagtcgaagagctgtatcca
tttcctgcgaaagaaataaaagagctcttcgctaaattgccgaatcttgaagaaattgtc
tgggttcaggaagagccgcaaaacatgggagcatggagttacatcagtccttatttatca
gaagttgcaccagagggagtaagtgttcaatatattggtcggagaagacggtcaagtccg
gcagagggcgatccgacagttcataaaaaagaacaagaacgcattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system