KEGG   Bacillus atrophaeus NRS 1221A: TD68_19985Help
Entry
TD68_19985        CDS       T03711                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
batr  Bacillus atrophaeus NRS 1221A
Pathway
batr00473  D-Alanine metabolism
batr00550  Peptidoglycan biosynthesis
batr01100  Metabolic pathways
batr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:batr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    TD68_19985 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TD68_19985 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    TD68_19985 (ddl)
Enzymes [BR:batr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TD68_19985 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:batr01011]
 Precursor biosynthesis
  Amino acid ligase
   TD68_19985 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AJF87573
LinkDB All DBs
Position
4076096..4077181
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEEGEWQRGARLTEPVSN
VKMLQLEQNGSSFSPAALNKEMFPGDSSKENEAIDVVFPLLHGPNGEDGTIQGLLELLNI
PYVGNGVLASSAGMDKVVMKHLFAQAGLSQAKYAAFLKKDWSRSSEECCEQVEKELGYPC
FVKPANLGSSVGISKCRSREELEKAFELAFQYDRKVVVEEGVIGREIEIGVLGNDEPKCS
VVGEIAPKTDFYDYKAKYEDGDTDLIIPAEVTDDQYAKISDMAIKAFKAIDGSGLVRADF
FLTADGEVLINEVNTMPGFTPFSMFPLLWKEAGIEYADLIEQLVDLAKERHAEKQLIKHT
C
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattggtgtacggcggcaagtcagccgagcataacgtttcgctg
cagacagctttggctgtaacaaaagcgctaaatactgagaagtttgatatacatccgatt
tatattactgaagaaggcgagtggcaaagaggggcgcgcttaactgagccggtctctaat
gtgaaaatgctccagctcgaacaaaacgggagctctttttccccggcagctttgaataaa
gaaatgttcccgggagattcttcgaaagaaaacgaagcgattgatgttgtatttccgcta
ttgcacggtccaaatggagaagacggcacaatccaagggctgcttgaactattaaatatt
ccttatgtcggtaacggagtgcttgcttcttctgcgggtatggataaagttgtgatgaaa
cacttatttgcacaagcaggcctttcacaggctaagtatgcggctttccttaaaaaagat
tggagccgttcttctgaggaatgctgtgaacaagttgaaaaggaactgggctatccatgc
tttgtgaaaccggcgaacctgggttcaagcgtcggaatcagcaagtgccgcagccgtgaa
gaattggaaaaagcgtttgagcttgcgttccaatatgaccgcaaagtagtggtggaagaa
ggcgtcatcggccgggaaattgaaatcggcgttctcggaaatgatgaaccgaaatgctcc
gttgtcggagaaattgcacctaaaactgatttctatgattataaagcgaaatacgaagac
ggggacactgaccttatcattccggcggaagtgacggatgaccaatacgctaaaatcagt
gacatggcgatcaaagctttcaaagcaattgacggatcaggtcttgtcagagcggacttt
ttcctgacagctgacggcgaagtgctgatcaatgaagtcaacacgatgccggggttcacg
ccattcagcatgttcccgcttctctggaaagaagcaggcattgaatacgccgacttaatt
gaacagcttgttgatctggcaaaggaacggcatgcagaaaaacaattgattaaacataca
tgttaa

DBGET integrated database retrieval system