KEGG   Bartonella australis: BAnh1_06160Help
Entry
BAnh1_06160       CDS       T02469                                 

Gene name
topA
Definition
(GenBank) DNA topoisomerase I
  KO
K03168  DNA topoisomerase I [EC:5.6.2.1]
Organism
baus  Bartonella australis
Brite
KEGG Orthology (KO) [BR:baus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:baus03032]
    BAnh1_06160 (topA)
   03400 DNA repair and recombination proteins [BR:baus03400]
    BAnh1_06160 (topA)
Enzymes [BR:baus01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     BAnh1_06160 (topA)
DNA replication proteins [BR:baus03032]
 Prokaryotic type
  DNA Topoisomerases
   BAnh1_06160 (topA)
DNA repair and recombination proteins [BR:baus03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      BAnh1_06160 (topA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Topoisom_bac Toprim_C_rpt Toprim zf-C4_Topoisom Toprim_4
Motif
Other DBs
NCBI-ProteinID: AGF74495
UniProt: M1P3W0
LinkDB All DBs
Position
complement(775703..778243)
Genome map
AA seq 846 aa AA seqDB search
MDIVIVESPAKAKTINKYLGPQYKVVASFGHVRDLSAKDGSVLPDEDFSMKWDIGAASAK
RLNEIAKAVKEADSLILATDPDREGEAISWHILDVLKQKKILKDKPIKRVVFNAITKKSV
LDAMSNPRNIDESLVDAYLARRALDYLVGFTLSPVLWRKLPGARSAGRVQSVALRIICDR
ESEIERFIKEDYWSIETFLKTPRNDSFHARLLALNHKKLDKLDIQSQEQADKICLMLENA
VYRTLNVEAKPIKRNPSPPFTTSTLQQAASSKLGFSASRTMQLAQKLYEGIEINGEVAGL
ITYMRTDGVQMASEAIHSAREVIIDSFGGNYLPEKPRFYSTKAKNAQEAHEAIRPTDFKR
TPDQVRNFLDSDQAKLYELIWKRAIASQMRSAEIERTTVEIEALQGEDSANLRATGSIIR
FDGFISAYTDQQDEENGEKNESTRLPEINIDETLTKEKIESIQHTTEPPPRYSEASLIKK
LEELGIGRPSTYASTLATLSDRGYIMVDKRKLIPDVKGRIVTAFLENFFNRYVEYGFTAN
LEEKLDLISDGKLSWKDVLRDFWSGFNASITNIQELRITDILDVLNVTLAPLAFPAREDG
GDSRSCPLCANGRLSLKLGRYGAFVGCSNYPECKYTHKLGSDTEEKDEAVYNNEPTLLGI
DPETGGNVSLRNGRFGPYIQLGESKEAKRAGLPKEWKINNIDLDKALALLSLPREVGVHP
ETGKIITAATGRYGPYLAHDGKYATLPNIDEVFDIGINRAVTVLAEKQKNETKRDKTASS
VLETLGDHPDGGTVTVRSGRYGPYVNWGKINATLPKDKDPISVTLSEALELISAKVSTKK
TTSKKK
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtcatcgtcgagtccccggcaaaggcaaaaacaattaataaatacctcgga
cctcagtataaagtagtggcatcttttggacacgttcgtgatttatccgcaaaagacggc
tccgttttacctgatgaagatttttccatgaagtgggatattggcgccgcctccgcaaaa
cgtttaaatgaaatagcaaaagcagttaaagaagctgatagtcttattttggcaactgac
cctgatcgcgaaggagaggctatttcatggcatattcttgatgttcttaagcaaaaaaaa
attctaaaagataaacctattaagcgggttgtctttaacgcaattacaaaaaaatctgtg
cttgatgccatgagcaatccgcgcaacattgatgaatcacttgtagacgcttaccttgca
cgccgcgcccttgactatctggttggctttacgctttcacccgtcttgtggcgcaaattg
cccggtgcgcgttccgctggtcgtgtccaatcggtcgctttacgtattatttgcgatcgc
gaatcagaaatagaacgctttattaaagaagattattggtcaatcgagacatttttaaaa
acacccagaaacgatagttttcatgcacgattattagcacttaatcacaaaaagctcgac
aaacttgatattcaatctcaagaacaagcggacaagatctgccttatgctggaaaacgcg
gtataccgcacactaaatgttgaagcaaaacccataaaaagaaatccttccccgccattt
acaacatctacgctacagcaagcagcttcttcaaaattaggtttctcagcttctcgcacc
atgcaacttgcccaaaagctttatgagggtatcgaaattaatggtgaagtagcgggactt
attacttatatgcgtactgatggtgtgcaaatggcgtcagaagctatccattcagcacga
gaagtaattattgattcttttggtggtaattatctccctgaaaaaccacgtttttactca
acaaaagcaaaaaatgctcaagaagcgcacgaagctatccgcccaacagattttaagcgt
actcctgatcaagtacgtaattttctcgatagcgatcaagcaaaactttatgaattgata
tggaaacgcgctattgctagccaaatgcgctccgcagaaattgaacgtacgactgtcgaa
attgaagcgctgcaaggagaggatagtgcaaatctgcgtgcaacaggttctattattcgt
tttgatggctttatttccgcctacactgaccagcaagatgaagaaaatggcgaaaagaat
gaatcaacgcgcttgccagagattaatatcgatgaaacgcttacaaaagaaaaaattgaa
tcaatacaacatacaacagaaccgcctcctcgttattctgaagcttcgttaattaaaaaa
ctcgaagaactagggattgggcggccctcaacttatgcatctacattggcaacactttct
gatcgtggttatatcatggttgataaacgaaagctcattcccgatgttaaagggcgcatc
gttacagctttccttgaaaacttttttaatcgttatgtagaatacggctttacagcgaac
cttgaagaaaaactagaccttatatcggatggaaaactttcttggaaagatgttttacgc
gatttttggagcggatttaatgcgtccatcaccaacattcaggaattgcgtataacagat
atcctcgatgtcttaaatgtaacgttagcgcctctcgctttccccgcgcgcgaagacggg
ggtgattctcgctcttgccctctatgtgcgaatggccggttatcgctaaaattaggccgt
tacggagctttcgttggatgttccaactatcctgaatgtaaatatacacacaaactcggc
tcggatacagaagaaaaagatgaagctgtatataataatgaacctacccttcttggtatt
gatcctgaaacaggaggtaatgtctcacttcgtaatggccgctttgggccgtatattcaa
ctcggtgaaagcaaagaggccaaacgcgcaggattaccaaaagaatggaaaataaataat
attgatcttgataaagctttggctttattatctctcccccgtgaagttggagttcatcct
gaaacaggtaaaataatcacagcagcaaccggacggtacggcccttatctcgcacacgat
ggaaaatacgcaacccttcctaatatagacgaagtcttcgatatcggcataaatcgggct
gttacagtgcttgcagaaaagcaaaaaaatgaaacaaaacgggataaaaccgcatcttcc
gtactagaaacattaggggatcatccagatggtgggaccgtcaccgtacgtagcgggcgt
tacggcccgtacgtcaattggggcaaaatcaacgcaacattaccaaaagacaaagaccca
attagtgtgactctttcagaagcattagagcttatatcagccaaagtatccaccaaaaaa
acgacttccaagaagaaataa

DBGET integrated database retrieval system