KEGG   Bartonella australis: BAnh1_10070Help
Entry
BAnh1_10070       CDS       T02469                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
baus  Bartonella australis
Pathway
baus00473  D-Alanine metabolism
baus01100  Metabolic pathways
baus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAnh1_10070 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BAnh1_10070 (alr)
Enzymes [BR:baus01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BAnh1_10070 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:baus01011]
 Precursor biosynthesis
  Racemase
   BAnh1_10070 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF357 Indigoidine_A Corona_NS1
Motif
Other DBs
NCBI-ProteinID: AGF74877
UniProt: M1NZN0
LinkDB All DBs
Position
1260724..1261872
Genome map
AA seq 382 aa AA seqDB search
MDKPDNYEKNALFFYTAVATIDLGAIAENYTILSQRTAPIECSAVVKANAYGMGVEKIAP
TLYHAGCRTFFIAQITEALQLKAILPPDATLALLNDIPPTAEEFIAQSGIVPVLNSWQTI
ESWRTLCQKTGKKFPAIVQIDTGMNRSGLNQKELQQLINDPSLFAKADIKYVMSHLANAD
DATHPFNRVQLAATKTALAQLPACKASLANSGGIFLGPDFYFDLVRPGIALYGIDPHKKY
PTSLKPVLKLEAQVMQSQNIDAGMPVGYGGSFITRRSSVLATISVGYADGWLRALSNKGA
VYFNGHKLPITGRVSMDSIIVDATDLKDKKPERGDWVELIGTHQTIENISADANSIPHEI
LASLGSRCKRIYIEAIQKRSKL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggataaacccgacaattatgagaaaaacgcgctatttttctacacagctgtagcaacc
attgatcttggtgctatcgctgaaaattacacgattttatctcaacgcaccgccccaata
gaatgttcagccgtcgtaaaagccaacgcttatggaatgggtgttgaaaaaattgctccc
acgctttatcacgctggttgccgcactttttttatcgcccaaattacagaagcgcttcag
ttaaaagctattttaccgcctgatgctaccctcgcgctccttaatgatattccgcccacc
gcagaagaatttatagctcaatccggtatcgtgcccgttctcaattcgtggcaaacgatt
gaaagctggcgaacactttgccaaaaaacagggaaaaaatttccggcaatcgttcaaatt
gacaccggtatgaaccggtcaggacttaatcaaaaagaattacaacagctgatcaatgac
ccctctctttttgcaaaagcagatataaaatatgtcatgagccatcttgccaatgcagat
gatgctacacatcccttcaaccgcgttcaattagcggctacaaaaacagcacttgcacaa
ctgcccgcttgtaaagcttcccttgccaattctggaggcatctttctgggtccagatttt
tattttgatcttgtccgtccgggtatcgcactttacgggattgatcctcacaaaaaatat
cctacgtccctcaaacctgttttaaaacttgaggcccaagtcatgcaaagccaaaatatc
gatgcaggaatgccagttggctacggaggcagtttcattacccgccgatcaagtgtcctg
gcaaccatttctgtcggttatgcagatggctggctacgcgccctttccaacaaaggagct
gtttattttaacggacacaaactgcctattactggacgagtctctatggactccataatc
gttgacgcaaccgacctcaaagataaaaaacctgaaagaggcgactgggtggagctcatt
ggaacacaccagaccattgaaaatatttctgcggatgcaaacagcattcctcatgaaatt
ctagcttcccttggttctcgttgtaaacgtatttacattgaagctatccaaaaacgatca
aagctataa

DBGET integrated database retrieval system