KEGG   Bartonella australis: BAnh1_12130Help
Entry
BAnh1_12130       CDS       T02469                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
baus  Bartonella australis
Pathway
baus00020  Citrate cycle (TCA cycle)
baus00190  Oxidative phosphorylation
baus00650  Butanoate metabolism
baus01100  Metabolic pathways
baus01110  Biosynthesis of secondary metabolites
baus01120  Microbial metabolism in diverse environments
baus01130  Biosynthesis of antibiotics
baus01200  Carbon metabolism
Module
baus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
baus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
baus_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:baus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAnh1_12130 (sdhB)
   00650 Butanoate metabolism
    BAnh1_12130 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAnh1_12130 (sdhB)
Enzymes [BR:baus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAnh1_12130 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BAnh1_12130 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AGF75081
UniProt: M1PEL5
LinkDB All DBs
Position
complement(1505554..1506333)
Genome map
AA seq 259 aa AA seqDB search
MVQIRLPKNSRVKAGKVWPKPEGAERVTEFHVYRWSPDDEENPRLDTYYVDRSACGPMIL
DGLLFIKNHIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMDDVRHPIKVYPLPSMP
VVKDLVPDLSHFYAQHRVIEPWLQTVSPEPVKEWLQSYSDRQKIDGLYECILCACCQTSC
PSYWWNGDRYLGPAILLQAYRWIADSRDEMCGERLDNLEDPFRLYRCHTIMNCTQTCPKG
LNPAKAIAEIKKLMIERRL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaattaggctccctaaaaattctcgagttaaagctgggaaagtttggcctaaa
ccggagggtgctgagcgggtgacggaatttcacgtttatcgttggtcgccagatgatgag
gagaatcctcgtcttgatacctattacgtggaccgttcagcttgcggcccgatgattctt
gacggccttttgttcattaagaatcacattgacccaactttaacgcttcgtcggtcgtgt
cgtgaaggtatctgtggttcatgtgcgatgaacattgacgggacgaatacgctggcatgt
acaaaaggtatggacgacgtgcgacacccaattaaagtgtatccactcccttctatgccg
gttgttaaagatctagttcctgatttaagccacttttatgcgcagcaccgcgttattgaa
ccttggctgcagactgtttcacctgagcctgtaaaagagtggttgcaaagctactctgat
cgtcaaaaaatagacggtttgtacgagtgtattctttgcgcatgttgtcagacgtcgtgc
ccgagttattggtggaacggcgatcgttatttagggccggctattttattgcaggcttac
cgttggattgccgattcgcgtgatgagatgtgcggtgagcgtctcgataatctggaagat
cctttccggctttaccggtgccatacaattatgaattgtacgcaaacttgtccgaagggt
ttaaatccagctaaggcgattgctgaaattaagaagcttatgattgagcgccgcctttaa

DBGET integrated database retrieval system