KEGG   Bartonella australis: BAnh1_12140Help
Entry
BAnh1_12140       CDS       T02469                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
baus  Bartonella australis
Pathway
baus00020  Citrate cycle (TCA cycle)
baus00190  Oxidative phosphorylation
baus00650  Butanoate metabolism
baus01100  Metabolic pathways
baus01110  Biosynthesis of secondary metabolites
baus01120  Microbial metabolism in diverse environments
baus01130  Biosynthesis of antibiotics
baus01200  Carbon metabolism
Module
baus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
baus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
baus_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:baus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAnh1_12140 (sdhA)
   00650 Butanoate metabolism
    BAnh1_12140 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAnh1_12140 (sdhA)
Enzymes [BR:baus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAnh1_12140 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BAnh1_12140 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGF75082
UniProt: M1P0B4
LinkDB All DBs
Position
complement(1506349..1508193)
Genome map
AA seq 614 aa AA seqDB search
MVSTMSSLGARAGNAPYSYVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRS
HTVAAQGGIAASLANMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGV
PFSRTQEGKIYQRPFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIE
YFALDLIMTDGVCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGG
MVARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSFKDLA
SRDLVSRCITLEIREGRGVGPKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDVTKE
PIPVLPTVHYNMGGIPTNYFGEVLNPTADSPDRVQPGLMAVGEAGCASVHGANRLGSNSL
IDLVVFGRAAAIRAGEVIDRNAEIPPLNEVVVDEIIARFDRLRFAKGDMPTAMLREKMQR
AMQEDAAVFRTADSLQQGCRRMSKIWDELSDIKVTDRSLIWNSDLVETLELENLMANAIT
TVYSAEARLESRGAHAREDYPERDDKNWRHHTLSRLSKDGKVTLSYRPVHVDPLTSEVDG
GIELKRIAPKKRVY
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtacgatgtcatctttaggtgcgagagcgggtaacgcgccttatagctacgtg
gatcataaatttgatgttgttgttgttggcgcaggtggtgccggtttgcgcgcaactctt
ggtatggccgagcagggattgagaacagcgtgtatcacgaaggttttcccaaccagatca
cacacggttgcagcacaaggtggcattgcggcatcgctcgcaaatatgggacctgataat
tggcagtggcacttgtatgacacagtcaaagggtctgattggcttggcgatactgatgca
atggaatatctggtgcgtaacgcgccggcggctgtttatgaattggagcattatggggtt
cctttttcacgcacacaagagggaaaaatttatcaacgtccttttggtgggcatacgaca
gaatttggagaagggccaccagttcaacgtacttgtgctgcggctgatcgcaccggtcat
gcgattttgcacacactttacgggcagagcttaaagcataatgcgcaattttttatcgaa
tatttcgcacttgatttgatcatgaccgatggtgtgtgtacgggcgttgttgcgtggaat
cttgatgatggtacaatccaccgcttttctgcaaaaatggtcgttcttgcaacaggtggt
tacgggcgtgcttatttttctgccacatcggctcatacttgtacaggcgatggtggggga
atggtagcgcgcgctggattaccgcttcaggatatggaatttgttcaatttcatcctaca
ggtatttatggctccggttgcttaatcacggaaggagcgcggggtgaaggaggctattta
gtcaattctgagggtgaacgctttatggaacgttatgccccttcttttaaagatttggct
tcgcgtgatctggtttcacgttgtataacgcttgaaattcgcgaagggcgcggtgttggt
cccaagaaggatcatattcatttggttctcaaccatattgaccccgctatattgcacgag
cgtttgccaggaatatctgagtcagcgcggatttttgcaggtgttgacgtaacgaaagaa
cctatccctgttcttccaacagttcattataatatgggtggtattcccactaattacttt
ggggaagttttaaatccgacggctgattcccctgatcgcgttcagccgggtttgatggcg
gtgggagaggcaggatgtgcttctgtccatggtgctaatcgtttaggctcaaattcactc
attgatcttgtagtgttcgggcgcgcagcggcgattcgtgccggtgaagtgatcgaccgt
aatgcggagattccgccacttaatgaagtagttgtcgatgagattatagcgcgttttgac
cgtttgcgcttcgctaaaggggatatgccaacggctatgctgcgcgagaaaatgcagcgc
gctatgcaggaagatgcagcagtgttccgtacagctgattctttgcaacaagggtgccgg
cggatgagcaaaatttgggatgagttgtccgatattaaagtgacagaccgttcgttaata
tggaattctgatttagtagaaacattagaacttgaaaatctcatggctaatgcaatcacg
actgtttattccgcggaggcgcgtttggagagccgcggggcgcatgcacgtgaagattat
ccagagcgtgatgataaaaattggcgtcatcatacgctttcgcgtttatcaaaagacggg
aaagtgacattgtcatatcggcctgttcatgtagatccattaacctctgaagtggatggc
ggtattgaattgaaacgcattgctcctaagaaacgtgtttactaa

DBGET integrated database retrieval system