KEGG   Bordetella avium: BAV0657Help
Entry
BAV0657           CDS       T00695                                 

Definition
(GenBank) Putative oxygenase (small subunit)
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
bav  Bordetella avium
Pathway
bav00627  Aminobenzoate degradation
bav01100  Metabolic pathways
bav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAV0657
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BAV0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 DUF4440 DUF3225 SnoaL_2 SnoaL
Motif
Other DBs
NCBI-ProteinID: CAJ48262
UniProt: Q2KXG9
LinkDB All DBs
Position
683276..683773
Genome map
AA seq 165 aa AA seqDB search
MFNAMSKPDDLRALRAELRDLYEDYAFCLDEGDLEAWPDFFTEDCHYRVLSRENHDAGLP
LGLIYCMNKNMLKDRVTALRETTMFEPRSLRHFIGGVMVRERRGEEVVAQANFAIMESLS
DREPSLNMVGRYLDVWRQTDAGWRLASRDCVYDNYRVRTSLIVPI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgctatgtctaagcctgacgatctgcgcgccctgcgcgccgaactgcgcgat
ctgtacgaggattacgccttttgcctggatgagggcgacctcgaagcctggcccgatttc
tttaccgaagactgtcattaccgcgtgctgtcgcgcgagaaccatgatgccggcctgccg
ctgggcctgatctactgcatgaataaaaacatgctgaaagaccgggttacggcgctgcgc
gaaaccaccatgttcgagccgcgctcgctgcggcacttcatcggcggcgtgatggtgcgc
gagcgccggggcgaagaagtggtggcccaggccaatttcgccatcatggagtcgctgtcg
gatcgcgagcccagcctgaacatggtcggccgctatctcgacgtctggcgccagaccgac
gccggctggcgtctggccagccgcgactgcgtctatgacaactaccgggtgcgcacctcg
ctcatcgtgcccatctga

DBGET integrated database retrieval system